eF-site ID 5f34-B PDB Code 5f34 Chain B click to enlarge Title Crystal structure of membrane associated PatA from Mycobacterium smegmatis in complex with S-hexadecyl Coenzyme A - P21 space group Classification TRANSFERASE Compound Phosphatidylinositol mannoside acyltransferase Source Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) (ACYLT_MYCS2) Sequence B:  PEQLRRNLARVVGKPPADVPDDLIRASLASYARYWREAFR LPAMDHGRLGEQLDVIDIDHLWSALDAGRGAVLALPHSGN WDMAGVWLVQNYGPFTTVAERLKPESLYRRFVEYRESLGF EVLPLTGGERPPFEVLAERLTDNRPICLMAERDLTRSGVQ VDFFGEATRMPAGPAKLAIETGAALFPVHCWFEGDGWGMR VYPELDTSSGDVTAITQALADRFAANIATYPADWHMLQPQ WIADLSDERRARL Description Functional site 1) chain B residue 130 type sequence W description binding site for residue HD6 B 401 source : AC2 2) chain B residue 133 type sequence A description binding site for residue HD6 B 401 source : AC2 3) chain B residue 134 type sequence G description binding site for residue HD6 B 401 source : AC2 4) chain B residue 146 type sequence T description binding site for residue HD6 B 401 source : AC2 5) chain B residue 147 type sequence V description binding site for residue HD6 B 401 source : AC2 6) chain B residue 149 type sequence E description binding site for residue HD6 B 401 source : AC2 7) chain B residue 164 type sequence R description binding site for residue HD6 B 401 source : AC2 8) chain B residue 196 type sequence C description binding site for residue HD6 B 401 source : AC2 9) chain B residue 198 type sequence M description binding site for residue HD6 B 401 source : AC2 10) chain B residue 220 type sequence P description binding site for residue HD6 B 401 source : AC2 11) chain B residue 222 type sequence G description binding site for residue HD6 B 401 source : AC2 12) chain B residue 126 type ACT_SITE sequence H description Proton acceptor => ECO:0000305|PubMed:26965057, ECO:0000305|PubMed:29185694 source Swiss-Prot : SWS_FT_FI1 13) chain B residue 200 type ACT_SITE sequence E description ACT_SITE => ECO:0000305|PubMed:26965057, ECO:0000305|PubMed:29185694 source Swiss-Prot : SWS_FT_FI2 14) chain B residue 126 type BINDING sequence H description BINDING => ECO:0000305|PubMed:26965057 source Swiss-Prot : SWS_FT_FI3 15) chain B residue 164 type BINDING sequence R description BINDING => ECO:0000305|PubMed:26965057 source Swiss-Prot : SWS_FT_FI3 16) chain B residue 206 type BINDING sequence S description BINDING => ECO:0000305|PubMed:26965057 source Swiss-Prot : SWS_FT_FI3 17) chain B residue 229 type BINDING sequence E description BINDING => ECO:0000305|PubMed:26965057 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links