eF-site ID 5f2z-D PDB Code 5f2z Chain D click to enlarge Title Crystal structure of membrane associated PatA from Mycobacterium smegmatis in complex with palmitate - P21 space group Classification TRANSFERASE Compound Phosphatidylinositol mannoside acyltransferase Source Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) (ACYLT_MYCS2) Sequence D:  AGARYAARNGGPEQLRRNLARVVGKPPADVPDDLIRASLA SYARYWREAFRLPAMDHGRLGEQLDVIDIDHLWSALDAGR GAVLALPHSGNWDMAGVWLVQNYGPFTTVAERLKPESLYR RFVEYRESLGFEVLPLTGGERPPFEVLAERLTDNRPICLM AERDLTRSGVQVDFFGEATRMPAGPAKLAIETGAALFPVH CWFEGDGWGMRVYPELDTSSGDVTAITQALADRFAANIAT YPADWHMLQPQWIADL Description Functional site 1) chain D residue 126 type sequence H description binding site for residue PLM D 401 source : AC4 2) chain D residue 130 type sequence W description binding site for residue PLM D 401 source : AC4 3) chain D residue 133 type sequence A description binding site for residue PLM D 401 source : AC4 4) chain D residue 134 type sequence G description binding site for residue PLM D 401 source : AC4 5) chain D residue 164 type sequence R description binding site for residue PLM D 401 source : AC4 6) chain D residue 196 type sequence C description binding site for residue PLM D 401 source : AC4 7) chain D residue 126 type ACT_SITE sequence H description Proton acceptor => ECO:0000305|PubMed:26965057, ECO:0000305|PubMed:29185694 source Swiss-Prot : SWS_FT_FI1 8) chain D residue 200 type ACT_SITE sequence E description ACT_SITE => ECO:0000305|PubMed:26965057, ECO:0000305|PubMed:29185694 source Swiss-Prot : SWS_FT_FI2 9) chain D residue 126 type BINDING sequence H description BINDING => ECO:0000305|PubMed:26965057 source Swiss-Prot : SWS_FT_FI3 10) chain D residue 164 type BINDING sequence R description BINDING => ECO:0000305|PubMed:26965057 source Swiss-Prot : SWS_FT_FI3 11) chain D residue 206 type BINDING sequence S description BINDING => ECO:0000305|PubMed:26965057 source Swiss-Prot : SWS_FT_FI3 12) chain D residue 229 type BINDING sequence E description BINDING => ECO:0000305|PubMed:26965057 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links