eF-site ID 5f2z-A PDB Code 5f2z Chain A click to enlarge Title Crystal structure of membrane associated PatA from Mycobacterium smegmatis in complex with palmitate - P21 space group Classification TRANSFERASE Compound Phosphatidylinositol mannoside acyltransferase Source Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) (ACYLT_MYCS2) Sequence A:  GGPEQLRRNLARVVGKPPADVPDDLIRASLASYARYWREA FRLPAMDHGRLGEQLDVIDIDHLWSALDAGRGAVLALPHS GNWDMAGVWLVQNYGPFTTVAERLKPESLYRRFVEYRESL GFEVLPLTGGERPPFEVLAERLTDNRPICLMAERDLTRSG VQVDFFGEATRMPAGPAKLAIETGAALFPVHCWFEGDGWG MRVYPELDTSSGDVTAITQALADRFAANIATYPADWHMLQ PQWIADLS Description Functional site 1) chain A residue 126 type sequence H description binding site for residue PLM A 401 source : AC1 2) chain A residue 130 type sequence W description binding site for residue PLM A 401 source : AC1 3) chain A residue 133 type sequence A description binding site for residue PLM A 401 source : AC1 4) chain A residue 134 type sequence G description binding site for residue PLM A 401 source : AC1 5) chain A residue 164 type sequence R description binding site for residue PLM A 401 source : AC1 6) chain A residue 196 type sequence C description binding site for residue PLM A 401 source : AC1 7) chain A residue 198 type sequence M description binding site for residue PLM A 401 source : AC1 8) chain A residue 250 type sequence V description binding site for residue PLM A 401 source : AC1 9) chain A residue 126 type ACT_SITE sequence H description Proton acceptor => ECO:0000305|PubMed:26965057, ECO:0000305|PubMed:29185694 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 200 type ACT_SITE sequence E description ACT_SITE => ECO:0000305|PubMed:26965057, ECO:0000305|PubMed:29185694 source Swiss-Prot : SWS_FT_FI2 11) chain A residue 126 type BINDING sequence H description BINDING => ECO:0000305|PubMed:26965057 source Swiss-Prot : SWS_FT_FI3 12) chain A residue 164 type BINDING sequence R description BINDING => ECO:0000305|PubMed:26965057 source Swiss-Prot : SWS_FT_FI3 13) chain A residue 206 type BINDING sequence S description BINDING => ECO:0000305|PubMed:26965057 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 229 type BINDING sequence E description BINDING => ECO:0000305|PubMed:26965057 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links