eF-site ID 5epr-A
PDB Code 5epr
Chain A

click to enlarge
Title Crystal structure of the human BRPF1 bromodomain in complex with SEED11
Classification DNA BINDING PROTEIN
Compound Peregrin
Source Homo sapiens (Human) (BRPF1_HUMAN)
Sequence A:  MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLD
HIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKY
NAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Description (1)  Peregrin


Functional site

1) chain A
residue 657
type
ligand
sequence V
description binding site for residue 5QY A 801
source : AC1

2) chain A
residue 661
type
ligand
sequence E
description binding site for residue 5QY A 801
source : AC1

3) chain A
residue 662
type
ligand
sequence V
description binding site for residue 5QY A 801
source : AC1

4) chain A
residue 708
type
ligand
sequence N
description binding site for residue 5QY A 801
source : AC1

5) chain A
residue 714
type
ligand
sequence F
description binding site for residue 5QY A 801
source : AC1

6) chain A
residue 702
type
ligand
sequence S
description binding site for residue NO3 A 802
source : AC2

7) chain A
residue 705
type
ligand
sequence L
description binding site for residue NO3 A 802
source : AC2

8) chain A
residue 706
type
ligand
sequence K
description binding site for residue NO3 A 802
source : AC2

9) chain A
residue 715
type
ligand
sequence Y
description binding site for residue NO3 A 802
source : AC2

10) chain A
residue 722
type
ligand
sequence R
description binding site for residue NO3 A 802
source : AC2

11) chain A
residue 650-707
type prosite
ligand
sequence GNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN
FDDFEEDFNLIVSNCLKY
description Bromodomain signature.[STANVFHG]-x(2)-[FAS]-x(4)-[DNSPAKT]-x(0,7)-[DENQTFG]-Y-[HFYLRKT]-x(2)-[LIVMFY]-x(3)-[LIVM]-x(4)-[LIVM]-x(6,10)-Y-x(12,13)-[LIVM]-x(2)-N-[SACF]-x(2)-[FY].
source prosite : PS00633


Display surface

Download
Links