eF-site ID 5epr-A
PDB Code 5epr
Chain A

click to enlarge
Title Crystal structure of the human BRPF1 bromodomain in complex with SEED11
Classification DNA BINDING PROTEIN
Compound Peregrin
Source Homo sapiens (Human) (BRPF1_HUMAN)
Sequence A:  MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLD
HIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKY
NAKDTIFYRAAVRLREQGGAVLRQARRQAEKM
Description (1)  Peregrin


Functional site

1) chain A
residue 657
type
ligand
sequence V
description binding site for residue 5QY A 801
source : AC1

2) chain A
residue 661
type
ligand
sequence E
description binding site for residue 5QY A 801
source : AC1

3) chain A
residue 662
type
ligand
sequence V
description binding site for residue 5QY A 801
source : AC1

4) chain A
residue 708
type
ligand
sequence N
description binding site for residue 5QY A 801
source : AC1

5) chain A
residue 714
type
ligand
sequence F
description binding site for residue 5QY A 801
source : AC1

6) chain A
residue 702
type
ligand
sequence S
description binding site for residue NO3 A 802
source : AC2

7) chain A
residue 705
type
ligand
sequence L
description binding site for residue NO3 A 802
source : AC2

8) chain A
residue 706
type
ligand
sequence K
description binding site for residue NO3 A 802
source : AC2

9) chain A
residue 715
type
ligand
sequence Y
description binding site for residue NO3 A 802
source : AC2

10) chain A
residue 722
type
ligand
sequence R
description binding site for residue NO3 A 802
source : AC2

11) chain A
residue 650-707
type prosite
ligand
sequence GNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAYRYLN
FDDFEEDFNLIVSNCLKY
description
source prosite : PS00633

12) chain A
residue 652-653
type binding
ligand 5QY: (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one
sequence IF
description (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one binding site
source pdb_hetatom : 5QY_5epr_A_801

13) chain A
residue 657-658
type binding
ligand 5QY: (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one
sequence VP
description (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one binding site
source pdb_hetatom : 5QY_5epr_A_801

14) chain A
residue 661-662
type binding
ligand 5QY: (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one
sequence EV
description (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one binding site
source pdb_hetatom : 5QY_5epr_A_801

15) chain A
residue 665
type binding
ligand 5QY: (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one
sequence Y
description (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one binding site
source pdb_hetatom : 5QY_5epr_A_801

16) chain A
residue 704
type binding
ligand 5QY: (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one
sequence C
description (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one binding site
source pdb_hetatom : 5QY_5epr_A_801

17) chain A
residue 707-708
type binding
ligand 5QY: (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one
sequence YN
description (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one binding site
source pdb_hetatom : 5QY_5epr_A_801

18) chain A
residue 714
type binding
ligand 5QY: (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one
sequence F
description (3~{S})-3-methyl-3,4-dihydro-1~{H}-quinoxalin-2-one binding site
source pdb_hetatom : 5QY_5epr_A_801

19) chain A
residue 705
type binding
ligand NO3: NITRATE ION
sequence L
description NITRATE ION binding site
source pdb_hetatom : NO3_5epr_A_802

20) chain A
residue 710
type binding
ligand NO3: NITRATE ION
sequence K
description NITRATE ION binding site
source pdb_hetatom : NO3_5epr_A_802

21) chain A
residue 715
type binding
ligand NO3: NITRATE ION
sequence Y
description NITRATE ION binding site
source pdb_hetatom : NO3_5epr_A_802

22) chain A
residue 719
type binding
ligand NO3: NITRATE ION
sequence V
description NITRATE ION binding site
source pdb_hetatom : NO3_5epr_A_802

23) chain A
residue 722
type binding
ligand NO3: NITRATE ION
sequence R
description NITRATE ION binding site
source pdb_hetatom : NO3_5epr_A_802


Display surface

Download
Links