eF-site ID 5eni-A PDB Code 5eni Chain A click to enlarge Title Crystal structure of the second bromodomain of Pleckstrin homology domain interacting protein (PHIP) in complex with compound-13 N11537 (SGC - Diamond I04-1 fragment screening) Classification SIGNALING PROTEIN Compound PH-interacting protein Source (PHIP_HUMAN) Sequence A:  SMSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPD YRDIIDTPMDFATVRETLEAGNYESPMELCKDVRLIFSNS KAYTPSKRSRIYSMSLRLSAFFEEHISSVLSDYKSALRFH KRN Description Functional site 1) chain A residue 1340 type sequence P description binding site for residue 5QA A 1501 source : AC1 2) chain A residue 1345 type sequence V description binding site for residue 5QA A 1501 source : AC1 3) chain A residue 1395 type sequence Y description binding site for residue 5QA A 1501 source : AC1 4) chain A residue 1315 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI1 5) chain A residue 1359 type MOD_RES sequence T description Phosphothreonine => ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 1405 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI3 7) chain A residue 1338-1395 type prosite sequence SEPFRQPVDLLEYPDYRDIIDTPMDFATVRETLEAGNYES PMELCKDVRLIFSNSKAY description BROMODOMAIN_1 Bromodomain signature. SepFrqpvDlleyp..DYRdiIdtpMdfatVretleagn..Yespmelckdvrl.IfsNSkaY source prosite : PS00633

Display surface Download Links