eF-site ID 5ecg-B PDB Code 5ecg Chain B click to enlarge Title Crystal structure of the BRCT domains of 53BP1 in complex with p53 and H2AX-pSer139 (gammaH2AX) Classification ANTITUMOR PROTEIN Compound Cellular tumor antigen p53 Source Homo sapiens (Human) (5ECG) Sequence B:  SVPSQKTYQGSYGFRLGFLVTCTYSPALNKMFCQLAKTCP VQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERC GLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVG SDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLG RNSFEVRVCACPGRDRRTEEENL Description Functional site 1) chain B residue 176 type sequence C description binding site for residue ZN B 401 source : AC2 2) chain B residue 179 type sequence H description binding site for residue ZN B 401 source : AC2 3) chain B residue 238 type sequence C description binding site for residue ZN B 401 source : AC2 4) chain B residue 242 type sequence C description binding site for residue ZN B 401 source : AC2 5) chain B residue 176 type MOD_RES sequence C description Phosphoserine => ECO:0000269|PubMed:19176521, ECO:0000269|PubMed:21144835 source Swiss-Prot : SWS_FT_FI2 6) chain B residue 179 type MOD_RES sequence H description Phosphoserine => ECO:0000269|PubMed:19176521, ECO:0000269|PubMed:21144835 source Swiss-Prot : SWS_FT_FI2 7) chain B residue 238 type MOD_RES sequence C description Phosphoserine => ECO:0000269|PubMed:19176521, ECO:0000269|PubMed:21144835 source Swiss-Prot : SWS_FT_FI2 8) chain B residue 242 type MOD_RES sequence C description Phosphoserine => ECO:0000269|PubMed:19176521, ECO:0000269|PubMed:21144835 source Swiss-Prot : SWS_FT_FI2 9) chain B residue 269 type MOD_RES sequence S description Phosphoserine; by AURKB => ECO:0000269|PubMed:20959462 source Swiss-Prot : SWS_FT_FI5 10) chain B residue 284 type MOD_RES sequence T description Phosphothreonine; by AURKB => ECO:0000269|PubMed:20959462 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links