eF-site ID 5dv4-A PDB Code 5dv4 Chain A click to enlarge Title Crystal structure of human CNOT6L in complex with neomycin Classification HYDROLASE Compound CCR4-NOT transcription complex subunit 6-like Source (CNO6L_HUMAN) Sequence A:  LPPRPWITLKERDQSASFTVMCYNVLCDKYATRQLYGYCP SWALNWEYRKKGIMEEIVNCDADIISLQEVETEQYFTLFL PALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEK FTLVQKHTVEFNQVAMANSDGSEAMLNRVMTKDNIGVAVV LEVHKELFKQLLIVANAHMHWDPEYSDVKLIQTMMFVSEV KNILEKASSRPNSIPLVLCADLNSLPDSGVVEYLSNGGVA DNHKDFKELRYNECLMNFSCEGRITHGFQLKSAYENNLMP YTNYTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENN ITGCPHPHIPSDHFSLLTQLELHP Description Functional site 1) chain A residue 206 type sequence L description binding site for residue NMY A 601 source : AC1 2) chain A residue 207 type sequence Y description binding site for residue NMY A 601 source : AC1 3) chain A residue 240 type sequence E description binding site for residue NMY A 601 source : AC1 4) chain A residue 360 type sequence H description binding site for residue NMY A 601 source : AC1 5) chain A residue 361 type sequence M description binding site for residue NMY A 601 source : AC1 6) chain A residue 363 type sequence W description binding site for residue NMY A 601 source : AC1 7) chain A residue 365 type sequence P description binding site for residue NMY A 601 source : AC1 8) chain A residue 371 type sequence K description binding site for residue NMY A 601 source : AC1 9) chain A residue 410 type sequence D description binding site for residue NMY A 601 source : AC1 10) chain A residue 412 type sequence N description binding site for residue NMY A 601 source : AC1 11) chain A residue 414 type sequence L description binding site for residue NMY A 601 source : AC1 12) chain A residue 479 type sequence N description binding site for residue NMY A 601 source : AC1 13) chain A residue 484 type sequence F description binding site for residue NMY A 601 source : AC1 14) chain A residue 488 type sequence I description binding site for residue NMY A 601 source : AC1 15) chain A residue 201 type sequence Y description binding site for residue SO4 A 602 source : AC2 16) chain A residue 363 type sequence W description binding site for residue SO4 A 602 source : AC2 17) chain A residue 243 type sequence T description binding site for residue SO4 A 603 source : AC3 18) chain A residue 244 type sequence E description binding site for residue SO4 A 603 source : AC3 19) chain A residue 278 type sequence K description binding site for residue SO4 A 603 source : AC3 20) chain A residue 410 type ACT_SITE sequence D description Proton donor/acceptor => ECO:0000305|PubMed:20628353, ECO:0000305|PubMed:27013054 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 240 type BINDING sequence E description BINDING => ECO:0000269|PubMed:20628353, ECO:0000269|PubMed:27013054, ECO:0007744|PDB:3NGN, ECO:0007744|PDB:5DV2 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 360 type BINDING sequence H description BINDING => ECO:0000269|PubMed:20628353, ECO:0000269|PubMed:27013054, ECO:0007744|PDB:3NGN, ECO:0007744|PDB:5DV2 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 412 type BINDING sequence N description BINDING => ECO:0000269|PubMed:20628353, ECO:0000269|PubMed:27013054, ECO:0007744|PDB:3NGN, ECO:0007744|PDB:5DV2 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 479 type BINDING sequence N description BINDING => ECO:0000269|PubMed:20628353, ECO:0000269|PubMed:27013054, ECO:0007744|PDB:3NGN, ECO:0007744|PDB:5DV2 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 276 type BINDING sequence E description BINDING => ECO:0000269|PubMed:20628353, ECO:0007744|PDB:3NGN source Swiss-Prot : SWS_FT_FI3 26) chain A residue 365 type BINDING sequence P description BINDING => ECO:0000269|PubMed:20628353 source Swiss-Prot : SWS_FT_FI4 27) chain A residue 410 type BINDING sequence D description BINDING => ECO:0000269|PubMed:20628353, ECO:0007744|PDB:3NGQ source Swiss-Prot : SWS_FT_FI5 28) chain A residue 484 type BINDING sequence F description BINDING => ECO:0000269|PubMed:20628353, ECO:0000269|PubMed:27013054, ECO:0007744|PDB:5DV2 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links