eF-site ID 5dui-AB PDB Code 5dui Chain A, B click to enlarge Title Identification of a new FoxO1 binding site that precludes CREB binding at the glucose-6-phosphatase catalytic subunit gene promoter Classification TRANSCRIPTION/dna Compound Forkhead box protein O1 Source Homo sapiens (Human) (5DUI) Sequence A:  WGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKD KGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWML NPEGGK B:  GNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDK GDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLN PEGGK Description Functional site 1) chain A residue 209-215 type prosite sequence WKNSIRH description FORK_HEAD_2 Fork head domain signature 2. WKNSIRH source prosite : PS00658 2) chain A residue 212 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403, ECO:0000269|PubMed:19221179, ECO:0000269|PubMed:21245099 source Swiss-Prot : SWS_FT_FI3 3) chain B residue 212 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403, ECO:0000269|PubMed:19221179, ECO:0000269|PubMed:21245099 source Swiss-Prot : SWS_FT_FI3 4) chain A residue 218 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI4 5) chain A residue 234 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI4 6) chain A residue 235 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI4 7) chain B residue 218 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI4 8) chain B residue 234 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI4 9) chain B residue 235 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI4 10) chain A residue 245 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q9R1E0 source Swiss-Prot : SWS_FT_FI5 11) chain B residue 245 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q9R1E0 source Swiss-Prot : SWS_FT_FI5 12) chain A residue 165 type SITE sequence Y description DNA-binding => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 225 type SITE sequence R description DNA-binding => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI2 14) chain B residue 165 type SITE sequence Y description DNA-binding => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI2 15) chain B residue 225 type SITE sequence R description DNA-binding => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links