eF-site ID 5dtz-C PDB Code 5dtz Chain C click to enlarge Title Crystal structure of rsFolder in the fluorescent on-state Classification FLUORESCENT PROTEIN Compound Green fluorescent protein Source Aequorea victoria (Jellyfish) (GFP_AEQVI) Sequence C:  TMVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDAT NGKLTLKFICTTGKLPVPWPTLVTTLXVLCFSRYPDHMKR HDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLV NRIELKGIDFKEDGNILGHKLEYNFNSHNVYITADKQKNG IKSNFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHY LSTQSKLSKDPNEKRDHMVLLEFVTAAGITH Description Functional site 1) chain C residue 98 type sequence T description binding site for residue PEG C 301 source : AC1 2) chain C residue 183 type sequence Y description binding site for residue PEG C 301 source : AC1 3) chain C residue 74 type sequence R description binding site for residue PEG D 302 source : AC3 4) chain C residue 76 type sequence P description binding site for residue PEG D 302 source : AC3 5) chain C residue 69 type MOD_RES sequence V description (Z)-2,3-didehydrotyrosine => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI1 6) chain C residue 68 type CROSSLNK sequence X description 5-imidazolinone (Ser-Gly) => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI2 7) chain C residue 70 type CROSSLNK sequence L description 5-imidazolinone (Ser-Gly) => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links