eF-site ID 5dpq-A PDB Code 5dpq Chain A click to enlarge Title Crystal Structure of E72A mutant of domain swapped dimer Human Cellular Retinol Binding Protein Classification Retinol Binding Protein Compound Retinol-binding protein 2 Source (RET2_HUMAN) Sequence A:  TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTK VIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDAYTKSLDNR HVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELT CGDQVCRQVFKKK Description Functional site 1) chain A residue 108 type sequence Q description binding site for residue ACT A 201 source : AC1 2) chain A residue 40 type sequence K description binding site for residue ACT A 202 source : AC2 3) chain A residue 72 type sequence A description binding site for residue ACT A 203 source : AC3 4) chain A residue 97 type sequence Q description binding site for residue ACT A 203 source : AC3 5) chain A residue 106 type sequence W description binding site for residue ACT A 203 source : AC3 6) chain A residue 6-23 type prosite sequence GTWEMESNENFEGYMKAL description FABP Cytosolic fatty-acid binding proteins signature. GTWeMesNeNFEgYMKAL source prosite : PS00214 7) chain A residue 40 type BINDING sequence K description BINDING => ECO:0000269|PubMed:18076076 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 108 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:18076076 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links