eF-site ID 5dg4-ABCD PDB Code 5dg4 Chain A, B, C, D click to enlarge Title Crystal structure of monomer human cellular retinol binding protein II-Y60L Classification TRANSPORT PROTEIN Compound Retinol-binding protein 2 Source (RET2_HUMAN) Sequence A:  TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTK VIDQDGDNFKTKTTSTFRNLDVDFTVGVEFDEYTKSLDNR HVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELT CGDQVCRQVFKKK B:  TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTK VIDQDGDNFKTKTTSTFRNLDVDFTVGVEFDEYTKSLDNR HVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELT CGDQVCRQVFKKK C:  TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTK VIDQDGDNFKTKTTSTFRNLDVDFTVGVEFDEYTKSLDNR HVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELT CGDQVCRQVFKKK D:  TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTK VIDQDGDNFKTKTTSTFRNLDVDFTVGVEFDEYTKSLDNR HVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELT CGDQVCRQVFKKK Description Functional site 1) chain A residue 72 type sequence E description binding site for residue ACT A 201 source : AC1 2) chain A residue 97 type sequence Q description binding site for residue ACT A 201 source : AC1 3) chain A residue 106 type sequence W description binding site for residue ACT A 201 source : AC1 4) chain A residue 40 type sequence K description binding site for residue ACT A 202 source : AC2 5) chain A residue 108 type sequence Q description binding site for residue ACT A 202 source : AC2 6) chain D residue 40 type sequence K description binding site for residue ACT D 201 source : AC3 7) chain D residue 106 type sequence W description binding site for residue ACT D 201 source : AC3 8) chain D residue 108 type sequence Q description binding site for residue ACT D 201 source : AC3 9) chain A residue 6-23 type prosite sequence GTWEMESNENFEGYMKAL description FABP Cytosolic fatty-acid binding proteins signature. GTWeMesNeNFEgYMKAL source prosite : PS00214 10) chain A residue 40 type BINDING sequence K description BINDING => ECO:0000269|PubMed:18076076 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 108 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:18076076 source Swiss-Prot : SWS_FT_FI1 12) chain B residue 40 type BINDING sequence K description BINDING => ECO:0000269|PubMed:18076076 source Swiss-Prot : SWS_FT_FI1 13) chain B residue 108 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:18076076 source Swiss-Prot : SWS_FT_FI1 14) chain C residue 40 type BINDING sequence K description BINDING => ECO:0000269|PubMed:18076076 source Swiss-Prot : SWS_FT_FI1 15) chain C residue 108 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:18076076 source Swiss-Prot : SWS_FT_FI1 16) chain D residue 40 type BINDING sequence K description BINDING => ECO:0000269|PubMed:18076076 source Swiss-Prot : SWS_FT_FI1 17) chain D residue 108 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:18076076 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links