eF-site ID 5cz8-b PDB Code 5cz8 Chain b click to enlarge Title Yeast 20S proteasome beta5-L(-49)S-K33A mutant in complex with Carfilzomib Classification HYDROLASE/HYDROLASE INHIBITOR Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae (strain ATCC 204508 / S288c); Sequence b:  TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDK IWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAAS VFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVH KLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLS QAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL Description Functional site 1) chain b residue 31 type sequence T description binding site for residue CL b 202 source : AD7 2) chain b residue 45 type sequence R description binding site for residue CL b 202 source : AD7 3) chain b residue 53 type sequence Q description binding site for residue CL b 202 source : AD7 4) chain b residue 2 type sequence S description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 5) chain b residue 3 type sequence I description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 6) chain b residue 20 type sequence T description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 7) chain b residue 21 type sequence T description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 8) chain b residue 22 type sequence T description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 9) chain b residue 33 type sequence K description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 10) chain b residue 45 type sequence R description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 11) chain b residue 46 type sequence S description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 12) chain b residue 47 type sequence G description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 13) chain b residue 48 type sequence S description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 14) chain b residue 49 type sequence A description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 15) chain b residue 128 type sequence G description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 16) chain b residue 129 type sequence S description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 17) chain b residue 130 type sequence G description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 18) chain b residue 168 type sequence S description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 19) chain b residue 169 type sequence S description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE1 20) chain b residue 2 type sequence S description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 21) chain b residue 3 type sequence I description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 22) chain b residue 20 type sequence T description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 23) chain b residue 21 type sequence T description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 24) chain b residue 22 type sequence T description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 25) chain b residue 33 type sequence K description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 26) chain b residue 45 type sequence R description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 27) chain b residue 46 type sequence S description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 28) chain b residue 47 type sequence G description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 29) chain b residue 48 type sequence S description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 30) chain b residue 49 type sequence A description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 31) chain b residue 128 type sequence G description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 32) chain b residue 129 type sequence S description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 33) chain b residue 130 type sequence G description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 34) chain b residue 168 type sequence S description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 35) chain b residue 169 type sequence S description binding site for Di-peptide 3BV b 201 and THR b 1 source : AE2 36) chain b residue 1 type ACT_SITE sequence T description Nucleophile => ECO:0000269|PubMed:9087403 source Swiss-Prot : SWS_FT_FI1 37) chain b residue 4-51 type prosite sequence MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWC CRSGSAAD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. ISMkYdnGVIIAADnlgsygsllrfngve.RlipvgdntvvgisGdiSD source prosite : PS00854

Display surface Download Links