eF-site ID 5cbx-B
PDB Code 5cbx
Chain B

click to enlarge
Title AncGR DNA Binding Domain - (+)GRE Complex
Classification dna binding protein/dna
Compound AncGR DNA Binding Domain
Source (5CBX)
Sequence B:  PPKICLVCGDEASGCHYGVLTCGSCKVFFKRAVEGQHNYL
CAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEA
Description (1)  AncGR DNA Binding Domain/DNA Complex


Functional site

1) chain B
residue 421
type
ligand
sequence C
description binding site for residue ZN B 501
source : AC3

2) chain B
residue 424
type
ligand
sequence C
description binding site for residue ZN B 501
source : AC3

3) chain B
residue 438
type
ligand
sequence C
description binding site for residue ZN B 501
source : AC3

4) chain B
residue 441
type
ligand
sequence C
description binding site for residue ZN B 501
source : AC3

5) chain B
residue 457
type
ligand
sequence C
description binding site for residue ZN B 502
source : AC4

6) chain B
residue 463
type
ligand
sequence C
description binding site for residue ZN B 502
source : AC4

7) chain B
residue 473
type
ligand
sequence C
description binding site for residue ZN B 502
source : AC4

8) chain B
residue 476
type
ligand
sequence C
description binding site for residue ZN B 502
source : AC4


Display surface

Download
Links