eF-site ID 5cbx-ABCDEFGH
PDB Code 5cbx
Chain A, B, C, D, E, F, G, H

click to enlarge
Title AncGR DNA Binding Domain - (+)GRE Complex
Classification dna binding protein/dna
Compound AncGR DNA Binding Domain
Source (5CBX)
Sequence A:  KICLVCGDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCA
GRNDCIIDKIRRKNCPACRFRKCLQAGMNLEA
B:  PPKICLVCGDEASGCHYGVLTCGSCKVFFKRAVEGQHNYL
CAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEA
C:  CCAGAACAGAGTGTTCTG
D:  TCAGAACACTCTGTTCTG
E:  PPKICLVCGDEASGCHYGVLTCGSCKVFFKRAVEGQHNYL
CAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLE
F:  PPKICLVCGDEASGCHYGVLTCGSCKVFFKRAVEGQHNYL
CAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEA
G:  TCAGAACACTCTGTTCTG
H:  CCAGAACAGAGTGTTCTG
Description (1)  AncGR DNA Binding Domain/DNA Complex


Functional site

1) chain A
residue 421
type
ligand
sequence C
description binding site for residue ZN A 501
source : AC1

2) chain A
residue 424
type
ligand
sequence C
description binding site for residue ZN A 501
source : AC1

3) chain A
residue 438
type
ligand
sequence C
description binding site for residue ZN A 501
source : AC1

4) chain A
residue 441
type
ligand
sequence C
description binding site for residue ZN A 501
source : AC1

5) chain A
residue 457
type
ligand
sequence C
description binding site for residue ZN A 502
source : AC2

6) chain A
residue 463
type
ligand
sequence C
description binding site for residue ZN A 502
source : AC2

7) chain A
residue 473
type
ligand
sequence C
description binding site for residue ZN A 502
source : AC2

8) chain A
residue 476
type
ligand
sequence C
description binding site for residue ZN A 502
source : AC2

9) chain B
residue 421
type
ligand
sequence C
description binding site for residue ZN B 501
source : AC3

10) chain B
residue 424
type
ligand
sequence C
description binding site for residue ZN B 501
source : AC3

11) chain B
residue 438
type
ligand
sequence C
description binding site for residue ZN B 501
source : AC3

12) chain B
residue 441
type
ligand
sequence C
description binding site for residue ZN B 501
source : AC3

13) chain B
residue 457
type
ligand
sequence C
description binding site for residue ZN B 502
source : AC4

14) chain B
residue 463
type
ligand
sequence C
description binding site for residue ZN B 502
source : AC4

15) chain B
residue 473
type
ligand
sequence C
description binding site for residue ZN B 502
source : AC4

16) chain B
residue 476
type
ligand
sequence C
description binding site for residue ZN B 502
source : AC4

17) chain E
residue 421
type
ligand
sequence C
description binding site for residue ZN E 501
source : AC5

18) chain E
residue 424
type
ligand
sequence C
description binding site for residue ZN E 501
source : AC5

19) chain E
residue 438
type
ligand
sequence C
description binding site for residue ZN E 501
source : AC5

20) chain E
residue 441
type
ligand
sequence C
description binding site for residue ZN E 501
source : AC5

21) chain E
residue 457
type
ligand
sequence C
description binding site for residue ZN E 502
source : AC6

22) chain E
residue 463
type
ligand
sequence C
description binding site for residue ZN E 502
source : AC6

23) chain E
residue 473
type
ligand
sequence C
description binding site for residue ZN E 502
source : AC6

24) chain E
residue 476
type
ligand
sequence C
description binding site for residue ZN E 502
source : AC6

25) chain F
residue 421
type
ligand
sequence C
description binding site for residue ZN F 501
source : AC7

26) chain F
residue 424
type
ligand
sequence C
description binding site for residue ZN F 501
source : AC7

27) chain F
residue 438
type
ligand
sequence C
description binding site for residue ZN F 501
source : AC7

28) chain F
residue 441
type
ligand
sequence C
description binding site for residue ZN F 501
source : AC7

29) chain F
residue 457
type
ligand
sequence C
description binding site for residue ZN F 502
source : AC8

30) chain F
residue 463
type
ligand
sequence C
description binding site for residue ZN F 502
source : AC8

31) chain F
residue 473
type
ligand
sequence C
description binding site for residue ZN F 502
source : AC8

32) chain F
residue 476
type
ligand
sequence C
description binding site for residue ZN F 502
source : AC8


Display surface

Download
Links