eF-site ID 5cba-F PDB Code 5cba Chain F click to enlarge Title 3B4 in complex with CXCL13 - 3B4-CXCL13 Classification IMMUNE SYSTEM Compound 3b4 heavy chain Source (CXL13_HUMAN) Sequence F:  SLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWK KNKSIVCVDPQAEWIQRMMEVLRK Description Functional site 1) chain F residue 6 type sequence S description binding site for residue EDO B 201 source : AC3 2) chain F residue 22 type sequence R description binding site for residue EDO C 201 source : AC4

Display surface Download Links