eF-site ID 5c6m-D PDB Code 5c6m Chain D click to enlarge Title Crystal structure of deoxyribose-phosphate aldolase from Shewanella halifaxensis Classification LYASE Compound Deoxyribose-phosphate aldolase Source Shewanella halifaxensis (strain HAW-EB4) (DEOC_SHEHH) Sequence D:  SDLKKAAQQAISLMDLTTLNDDDTDQKVIELCHKAKTPAG DTAAICIYPRFIPIARKTLNEIGGDDIKIATVTNFPHGND DIAIAVLETRAAVAYGADEVDVVFPYRALMEGNETVGFEL VKACKEACGEDTILKVIIESGVLADPALIRKASELSIDAG ADFIKTSTGKVAVNATLEAAEIMMTVISEKNPKVGFKPAG GVKDAAAAAEFLGVAARLLGDDWATPATFRFGASSLLTNL LHTLELAD Description Functional site 1) chain D residue 51 type sequence R description binding site for residue CL C 301 source : AC5 2) chain D residue 50 type sequence P description binding site for residue CL D 301 source : AC6 3) chain D residue 51 type sequence R description binding site for residue CL D 301 source : AC6 4) chain D residue 102 type ACT_SITE sequence D description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_00592 source Swiss-Prot : SWS_FT_FI1 5) chain D residue 198 type ACT_SITE sequence K description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_00592 source Swiss-Prot : SWS_FT_FI1 6) chain D residue 166 type ACT_SITE sequence K description Schiff-base intermediate with acetaldehyde => ECO:0000255|HAMAP-Rule:MF_00592 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links