eF-site ID 5c1u-B PDB Code 5c1u Chain B click to enlarge Title Crystal structure of EV71 3C Proteinase in complex with Compound Xb Classification HYDROLASE/HYDROLASE INHIBITOR Compound 3C proteinase Source (A9XG43_9ENTO) Sequence B:  MGPSLDFALSLLRRNVRQVQTDQGHFTMLGVRDRLAVLPR HSQPGKTIWIEHKLVNILDAVELVDEQGVNLELTLITLDT NEKFRDITKFIPENISTASDATLVINTEHMPSMFVPVGDV VQYGFLNLSGKPTHRTMMYNFPTKAGQCGGVVTSVGKVIG IHIGGNGRQGFCAGLKRSYFA Description Functional site 1) chain B residue 25 type sequence F description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 2) chain B residue 26 type sequence T description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 3) chain B residue 39 type sequence R description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 4) chain B residue 40 type sequence H description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 5) chain B residue 71 type sequence E description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 6) chain B residue 127 type sequence L description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 7) chain B residue 128 type sequence S description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 8) chain B residue 142 type sequence T description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 9) chain B residue 143 type sequence K description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 10) chain B residue 145 type sequence G description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 11) chain B residue 146 type sequence Q description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 12) chain B residue 148 type sequence G description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 13) chain B residue 149 type sequence G description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 14) chain B residue 161 type sequence H description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 15) chain B residue 162 type sequence I description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 16) chain B residue 163 type sequence G description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2 17) chain B residue 164 type sequence G description binding site for Di-peptide GHV B 201 and CYS B 147 source : AC2

Display surface Download Links