eF-site ID 5bo0-ABCD PDB Code 5bo0 Chain A, B, C, D click to enlarge Title Crystal structure of Human MCM2 HBD and ASF1b chaperoning a histone H3.2-H4 dimer Classification CHAPERONE/DNA BINDING PROTEIN Compound Histone H3.2 Source Homo sapiens (Human) (ASF1B_HUMAN) Sequence A:  TELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASE AYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER B:  RHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRG VLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRT LYGFGG C:  DGEELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTA SQREAAERAMRQRDREA D:  MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEW KIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPN PSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNP ELRENPPMKPDFSQLQRNILASNPRVTRFHINWD Description Functional site 1) chain A residue 62 type sequence I description binding site for residue GOL B 201 source : AC1 2) chain A residue 63 type sequence R description binding site for residue GOL B 201 source : AC1 3) chain B residue 29 type sequence I description binding site for residue GOL B 201 source : AC1 4) chain B residue 30 type sequence T description binding site for residue GOL B 201 source : AC1 5) chain B residue 33 type sequence A description binding site for residue GOL B 201 source : AC1 6) chain B residue 36 type sequence R description binding site for residue GOL B 201 source : AC1 7) chain D residue 69 type sequence R description binding site for residue GOL B 201 source : AC1 8) chain B residue 20 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:12086618, ECO:0000269|PubMed:15964846, ECO:0000269|PubMed:17967882, ECO:0000269|PubMed:27338793 source Swiss-Prot : SWS_FT_FI7 9) chain C residue 108 type MOD_RES sequence S description Phosphoserine; by ATR => ECO:0000269|PubMed:15210935, ECO:0000269|PubMed:16899510, ECO:0007744|PubMed:17525332, ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 66-74 type prosite sequence PFQRLVREI description HISTONE_H3_2 Histone H3 signature 2. PFqRLVREI source prosite : PS00959 11) chain B residue 91 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:19818714 source Swiss-Prot : SWS_FT_FI15 12) chain B residue 20 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI16 13) chain B residue 59 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI16 14) chain B residue 79 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI16 15) chain B residue 31 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in UFM1); alternate => ECO:0000269|PubMed:30886146 source Swiss-Prot : SWS_FT_FI17 16) chain B residue 59 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000269|PubMed:31542297 source Swiss-Prot : SWS_FT_FI10 17) chain B residue 79 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P62806 source Swiss-Prot : SWS_FT_FI11 18) chain B residue 80 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P62806 source Swiss-Prot : SWS_FT_FI12 19) chain B residue 88 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI13 20) chain B residue 44 type MOD_RES sequence K description N6-propionyllysine; alternate => ECO:0000269|PubMed:17267393 source Swiss-Prot : SWS_FT_FI5 21) chain B residue 31 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI6 22) chain B residue 77 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI6 23) chain B residue 91 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI6 24) chain B residue 47 type MOD_RES sequence S description Phosphoserine; by PAK2 => ECO:0000269|PubMed:21724829, ECO:0007744|PubMed:17081983, ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI8 25) chain B residue 51 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:15592455, ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI9

Display surface Download Links