eF-site ID 5bnj-AB PDB Code 5bnj Chain A, B click to enlarge Title CDK8/CYCC IN COMPLEX WITH 8-{3-Chloro-5-[4-(1-methyl-1H-pyrazol-4-yl)-phenyl]-pyridin- 4-yl}-2,8-diaza-spiro[4.5]decan-1-one Classification TRANSFERASE Compound Cyclin-dependent kinase 8 Source Homo sapiens (Human) (CCNC_HUMAN) Sequence A:  DKMDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKA KRKDGKDDKDYALKQIEGTGISMSACREIALLRELKHPNV ISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANQ LPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGE GPERGRVKIADMGFARLFNSPLTFWYRAPELLLGARHYTK AIDIWAIGCIFAELLTSEPIFHCRQNPYHHDQLDRIFNVM GFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEK HKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDP LPTSDVFAGCQIPYPKREFLTEE B:  KAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYW KLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSL KSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKT RFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRP LLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIA LACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLY EQWKNFDERKEMATILSKMPKPKPPP Description (1)  Cyclin-dependent kinase 8 (E.C.2.7.11.22,2.7.11.23), Cyclin-C Functional site 1) chain A residue 27 type sequence V description binding site for residue 4TV A 501 source : AC1 2) chain A residue 32 type sequence Y description binding site for residue 4TV A 501 source : AC1 3) chain A residue 50 type sequence A description binding site for residue 4TV A 501 source : AC1 4) chain A residue 52 type sequence K description binding site for residue 4TV A 501 source : AC1 5) chain A residue 97 type sequence F description binding site for residue 4TV A 501 source : AC1 6) chain A residue 98 type sequence D description binding site for residue 4TV A 501 source : AC1 7) chain A residue 100 type sequence A description binding site for residue 4TV A 501 source : AC1 8) chain A residue 106 type sequence H description binding site for residue 4TV A 501 source : AC1 9) chain A residue 173 type sequence D description binding site for residue 4TV A 501 source : AC1 10) chain A residue 356 type sequence R description binding site for residue 4TV A 501 source : AC1 11) chain A residue 14 type sequence E description binding site for residue FMT B 301 source : AC2 12) chain B residue 144 type sequence E description binding site for residue FMT B 301 source : AC2 13) chain A residue 71 type sequence R description binding site for residue FMT B 302 source : AC3 14) chain B residue 147 type sequence D description binding site for residue FMT B 302 source : AC3 15) chain A residue 27-52 type prosite sequence VGRGTYGHVYKAKRKDGKDDKDYALK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. VGRGTYGHVYkAkrkdgkddkd........YALK source prosite : PS00107 16) chain A residue 147-159 type prosite sequence VLHRDLKPANILV description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. VlHrDLKpaNILV source prosite : PS00108 17) chain A residue 27 type BINDING sequence V description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 52 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links