eF-site ID 5b41-AC PDB Code 5b41 Chain A, C click to enlarge Title Crystal structure of VDR-LBD complexed with 2-methylidene-19-nor-1a,25-dihydroxyvitamin D3 Classification TRANSCRIPTION Compound Vitamin D3 receptor Source (MED1_HUMAN) Sequence A:  KLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMPLS MLPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKS SAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAGH TLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPG VQDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQ KLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGN C:  KNHPMLMNLLK Description Functional site 1) chain A residue 143 type sequence Y description binding site for residue YSV A 501 source : AC1 2) chain A residue 223 type sequence L description binding site for residue YSV A 501 source : AC1 3) chain A residue 233 type sequence S description binding site for residue YSV A 501 source : AC1 4) chain A residue 270 type sequence R description binding site for residue YSV A 501 source : AC1 5) chain A residue 271 type sequence S description binding site for residue YSV A 501 source : AC1 6) chain A residue 274 type sequence S description binding site for residue YSV A 501 source : AC1 7) chain A residue 282 type sequence W description binding site for residue YSV A 501 source : AC1 8) chain A residue 284 type sequence C description binding site for residue YSV A 501 source : AC1 9) chain A residue 296 type sequence V description binding site for residue YSV A 501 source : AC1 10) chain A residue 301 type sequence H description binding site for residue YSV A 501 source : AC1 11) chain A residue 393 type sequence H description binding site for residue YSV A 501 source : AC1 12) chain A residue 143 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:15065852, ECO:0000269|PubMed:17227670 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 270 type BINDING sequence R description BINDING => ECO:0000269|PubMed:15065852, ECO:0000269|PubMed:17227670 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 314 type BINDING sequence V description BINDING => ECO:0000269|PubMed:15065852, ECO:0000269|PubMed:17227670 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 348 type BINDING sequence V description BINDING => ECO:0000269|PubMed:15065852, ECO:0000269|PubMed:17227670 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links