eF-site ID 5b1l-A PDB Code 5b1l Chain A click to enlarge Title The mouse nucleosome structure containing H3t Classification STRUCTURAL PROTEIN/DNA Compound Histone H3t Source (5B1L) Sequence A:  PHRYHPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQD FKTDLRFQSSAVMALQEACESYLVGLFEDTNLCAIHAKRV TIMPKDIQLARRIRGER Description Functional site 1) chain A residue 121 type sequence P description binding site for residue CL A 301 source : AC1 2) chain A residue 122 type sequence K description binding site for residue CL A 301 source : AC1 3) chain A residue 122 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P68431 source Swiss-Prot : SWS_FT_FI10 4) chain A residue 66-74 type prosite sequence PFQRLVREI description HISTONE_H3_2 Histone H3 signature 2. PFqRLVREI source prosite : PS00959 5) chain A residue 57 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P68431 source Swiss-Prot : SWS_FT_FI18 6) chain A residue 80 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P68431 source Swiss-Prot : SWS_FT_FI19 7) chain A residue 86 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI20 8) chain A residue 107 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI21 9) chain A residue 115 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000250|UniProtKB:P68431 source Swiss-Prot : SWS_FT_FI22 10) chain A residue 128 type MOD_RES sequence R description Phosphoarginine => ECO:0000305 source Swiss-Prot : SWS_FT_FI23 11) chain A residue 129 type MOD_RES sequence R description Phosphoarginine => ECO:0000305 source Swiss-Prot : SWS_FT_FI23 12) chain A residue 131 type MOD_RES sequence R description Phosphoarginine => ECO:0000255 source Swiss-Prot : SWS_FT_FI24 13) chain A residue 64 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000250|UniProtKB:P68431 source Swiss-Prot : SWS_FT_FI15 14) chain A residue 41 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P68431 source Swiss-Prot : SWS_FT_FI16 15) chain A residue 56 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI17 16) chain A residue 79 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI17

Display surface Download Links