eF-site ID 5b0o-D PDB Code 5b0o Chain D click to enlarge Title Structure of the FliH-FliI complex Classification HYDROLASE/MOTOR PROTEIN Compound Flagellum-specific ATP synthase Source Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (FLIH_SALTY) Sequence D:  TTRLTRWLTALDNFEAKMALLPAVRRYGRLTRATGLVLEA TGLQLPLGATCIIERQDGPETKEVESEVVGFNGQRLFLMP LEEVEGILPGARVYARNGHGDGLQSGKQLPLGPALLGRVL DGGGKPLDGLPAPDTLETGALITPPFNPLQRTPIEHVLDT GVRAINALLTVGRGQRMGLFAGSGVGKSVLLGMMARYTRA DVIVVGLIGERGREVKDFIENILGPDGRARSVVIAAPADV SPLLRMQGAAYATRIAEDFRDRGQHVLLIMDSLTRYAMAQ REIALAIGEPPATKGYPPSVFAKLPALVERAGNGIHGGGS ITAFYTVLTEGDDQQDPIADSARAILDGHIVLSRRLAEAG HYPAIDIEASISRAMTALITEQHYARVRLFKQLLSSFQRN RDLVSVGAYAKGSDPMLDKAITLWPQLEAFLQQGIFERAD WEDSLQALDLIFPT Description Functional site 1) chain D residue 184 type sequence S description binding site for residue ADP D 601 source : AC4 2) chain D residue 185 type sequence G description binding site for residue ADP D 601 source : AC4 3) chain D residue 186 type sequence V description binding site for residue ADP D 601 source : AC4 4) chain D residue 187 type sequence G description binding site for residue ADP D 601 source : AC4 5) chain D residue 188 type sequence K description binding site for residue ADP D 601 source : AC4 6) chain D residue 189 type sequence S description binding site for residue ADP D 601 source : AC4 7) chain D residue 190 type sequence V description binding site for residue ADP D 601 source : AC4 8) chain D residue 194 type sequence M description binding site for residue ADP D 601 source : AC4 9) chain D residue 363 type sequence Y description binding site for residue ADP D 601 source : AC4 10) chain D residue 434 type sequence Q description binding site for residue ADP D 601 source : AC4 11) chain D residue 436 type sequence I description binding site for residue ADP D 601 source : AC4 12) chain D residue 182 type BINDING sequence A description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links