eF-site ID 5b0o-A PDB Code 5b0o Chain A click to enlarge Title Structure of the FliH-FliI complex Classification HYDROLASE/MOTOR PROTEIN Compound Flagellum-specific ATP synthase Source Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (FLIH_SALTY) Sequence A:  TTRLTRWLTALDNFEAKMALLPAVRRYGRLTRATGLVLEA TGLQLPLGATCIIERQDGPETKEVESEVVGFNGQRLFLMP LEEVEGILPGARVYARGKQLPLGPALLGRVLDGGGKPLDG LPAPDTLETGALITPPFNPLQRTPIEHVLDTGVRAINALL TVGRGQRMGLFAGSGVGKSVLLGMMARYTRADVIVVGLIG ERGREVKDFIENILGPDGRARSVVIAAPADVSPLLRMQGA AYATRIAEDFRDRGQHVLLIMDSLTRYAMAQREIALAIGE PPATKGYPPSVFAKLPALVERAGNGIHGGGSITAFYTVLT EGDDQQDPIADSARAILDGHIVLSRRLAEAGHYPAIDIEA SISRAMTALITEQHYARVRLFKQLLSSFQRNRDLVSVGAY AKGSDPMLDKAITLWPQLEAFLQQGIFERADWEDSLQALD LIFPT Description Functional site 1) chain A residue 183 type sequence G description binding site for residue ADP A 601 source : AC1 2) chain A residue 185 type sequence G description binding site for residue ADP A 601 source : AC1 3) chain A residue 186 type sequence V description binding site for residue ADP A 601 source : AC1 4) chain A residue 187 type sequence G description binding site for residue ADP A 601 source : AC1 5) chain A residue 188 type sequence K description binding site for residue ADP A 601 source : AC1 6) chain A residue 189 type sequence S description binding site for residue ADP A 601 source : AC1 7) chain A residue 190 type sequence V description binding site for residue ADP A 601 source : AC1 8) chain A residue 363 type sequence Y description binding site for residue ADP A 601 source : AC1 9) chain A residue 434 type sequence Q description binding site for residue ADP A 601 source : AC1 10) chain A residue 435 type sequence G description binding site for residue ADP A 601 source : AC1 11) chain A residue 436 type sequence I description binding site for residue ADP A 601 source : AC1 12) chain A residue 182 type BINDING sequence A description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 364-373 type prosite sequence PAIDIEASIS description ATPASE_ALPHA_BETA ATP synthase alpha and beta subunits signature. PAIDIEASIS source prosite : PS00152

Display surface Download Links