eF-site ID 5ay8-E PDB Code 5ay8 Chain E click to enlarge Title Crystal structure of human nucleosome containing H3.Y Classification DNA BINDING PROTEIN/DNA Compound H3.Y Source (5AY8) Sequence E:  PHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQA ISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRV TIMPRDMQLARRLRRE Description Functional site 1) chain E residue 107 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI10 2) chain E residue 64 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI3 3) chain E residue 41 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI7 4) chain E residue 56 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI8 5) chain E residue 57 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI9 6) chain E residue 86 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI9

Display surface Download Links