eF-site ID 5ay8-A PDB Code 5ay8 Chain A click to enlarge Title Crystal structure of human nucleosome containing H3.Y Classification DNA BINDING PROTEIN/DNA Compound H3.Y Source (5AY8) Sequence A:  PHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQA ISPDLRFQSAAIGALQEASEAYLVQLFEDTNLCAIHARRV TIMPRDMQLARRLRREG Description Functional site 1) chain A residue 63 type sequence R description binding site for residue MN A 201 source : AC1 2) chain A residue 107 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI10 3) chain A residue 64 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI3 4) chain A residue 41 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI7 5) chain A residue 56 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI8 6) chain A residue 57 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI9 7) chain A residue 86 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI9 8) chain A residue 66-74 type prosite sequence PFQRLVREI description HISTONE_H3_2 Histone H3 signature 2. PFqRLVREI source prosite : PS00959

Display surface Download Links