eF-site ID 5avx-G
PDB Code 5avx
Chain G

click to enlarge
Title Kinetics by X-ray crystallography: Tl+-substitution of bound K+ in the E2.MgF42-.2K+ crystal after 20 min
Classification HYDROLASE/TRANSPORT PROTEIN
Compound Na, K-ATPase alpha subunit
Source ORGANISM_COMMON: Spiny dogfish; ORGANISM_SCIENTIFIC: Squalus acanthias;
Sequence G:  EGPDNDERFTYDYYRLRVVGLIVAAVLCVIGIIILLAGK
Description (1)  NA, K-ATPASE ALPHA SUBUNIT, NA+,K+-ATPASE BETA SUBUNIT, PHOSPHOLEMMAN-LIKE PROTEIN

Display surface

Download
Links