eF-site ID 5avf-B PDB Code 5avf Chain B click to enlarge Title The ligand binding domain of Mlp37 with taurine Classification SIGNALING PROTEIN Compound Methyl-accepting chemotaxis (MCP) signaling domain protein Source (A0A085T373_VIBCL) Sequence B:  GPLGSVRDEIRSMVSDSVDEIVDGVSKTTAEVINGRKSIA QYATSLIESNPEPDNVRTIISQPLIKNTFLLVGFGLEKDG SNINNDPSWNPGPTWDPRVRPWYKDAKNAGKLVITAPYAD SASGEILVSVATPVKDSATGQFLGSIFYDVSLAELAELVN EVKLFDAGYVFIVSEDGTTIAHPKKEFNGKPMSEFLGESK INVDTHQVIINGKPYAVSFSDVEGEDWYVGVVIDEEIAYA ALDE Description Functional site 1) chain B residue 141 type sequence W description binding site for residue TAU B 501 source : AC2 2) chain B residue 147 type sequence W description binding site for residue TAU B 501 source : AC2 3) chain B residue 152 type sequence R description binding site for residue TAU B 501 source : AC2 4) chain B residue 154 type sequence W description binding site for residue TAU B 501 source : AC2 5) chain B residue 170 type sequence Y description binding site for residue TAU B 501 source : AC2 6) chain B residue 172 type sequence D description binding site for residue TAU B 501 source : AC2 7) chain B residue 173 type sequence S description binding site for residue TAU B 501 source : AC2 8) chain B residue 199 type sequence F description binding site for residue TAU B 501 source : AC2 9) chain B residue 201 type sequence D description binding site for residue TAU B 501 source : AC2

Display surface Download Links