eF-site ID 5at1-D PDB Code 5at1 Chain D click to enlarge Title STRUCTURAL CONSEQUENCES OF EFFECTOR BINDING TO THE T STATE OF ASPARTATE CARBAMOYLTRANSFERASE. CRYSTAL STRUCTURES OF THE UNLIGATED AND ATP-, AND CTP-COMPLEXED ENZYMES AT 2.6-ANGSTROMS RESOLUTION Classification TRANSFERASE (CARBAMOYL-P,ASPARTATE) Compound ASPARTATE CARBAMOYLTRANSFERASE (T STATE), CATALYTIC CHAIN Source Escherichia coli (strain K12) (PYRI_ECOLI) Sequence D:  GVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLN LPSGEMGRKDLIKIENTFLSEDQVDQLALYAPQATVNRID NYEVVGKSRPSLPERIDNVLVCPNSNCISHAEPVSSSFAV RKRANDIALKCKYCEKEFSHNVVLAN Description (1)  ASPARTATE CARBAMOYLTRANSFERASE (ASPARTATE TRANSCARBAMYLASE) (T STATE) (E.C.2.1.3.2) COMPLEX WITH CYTIDINE 5-PRIME-TRIPHOSPHATE (CTP) Functional site 1) chain D residue 12 type sequence I description CTP binding site source : CTD 2) chain D residue 17 type sequence V description CTP binding site source : CTD 3) chain D residue 19 type sequence D description CTP binding site source : CTD 4) chain D residue 60 type sequence K description CTP binding site source : CTD 5) chain D residue 84 type sequence N description CTP binding site source : CTD 6) chain D residue 89 type sequence Y description CTP binding site source : CTD 7) chain D residue 91 type sequence V description CTP binding site source : CTD 8) chain D residue 94 type sequence K description CTP binding site source : CTD 9) chain D residue 109 type sequence C description ZN binding site source : ZND 10) chain D residue 114 type sequence C description ZN binding site source : ZND 11) chain D residue 138 type sequence C description ZN binding site source : ZND 12) chain D residue 141 type sequence C description ZN binding site source : ZND 13) chain D residue 109 type sequence C description BINDING SITE FOR RESIDUE ZN D 154 source : AC2 14) chain D residue 114 type sequence C description BINDING SITE FOR RESIDUE ZN D 154 source : AC2 15) chain D residue 138 type sequence C description BINDING SITE FOR RESIDUE ZN D 154 source : AC2 16) chain D residue 141 type sequence C description BINDING SITE FOR RESIDUE ZN D 154 source : AC2 17) chain D residue 11 type sequence A description BINDING SITE FOR RESIDUE CTP D 155 source : AC4 18) chain D residue 12 type sequence I description BINDING SITE FOR RESIDUE CTP D 155 source : AC4 19) chain D residue 17 type sequence V description BINDING SITE FOR RESIDUE CTP D 155 source : AC4 20) chain D residue 19 type sequence D description BINDING SITE FOR RESIDUE CTP D 155 source : AC4 21) chain D residue 20 type sequence H description BINDING SITE FOR RESIDUE CTP D 155 source : AC4 22) chain D residue 60 type sequence K description BINDING SITE FOR RESIDUE CTP D 155 source : AC4 23) chain D residue 82 type sequence T description BINDING SITE FOR RESIDUE CTP D 155 source : AC4 24) chain D residue 84 type sequence N description BINDING SITE FOR RESIDUE CTP D 155 source : AC4 25) chain D residue 86 type sequence I description BINDING SITE FOR RESIDUE CTP D 155 source : AC4 26) chain D residue 91 type sequence V description BINDING SITE FOR RESIDUE CTP D 155 source : AC4 27) chain D residue 94 type sequence K description BINDING SITE FOR RESIDUE CTP D 155 source : AC4 28) chain D residue 109 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 29) chain D residue 114 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 30) chain D residue 138 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 31) chain D residue 141 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links