eF-site ID 5akm-A PDB Code 5akm Chain A click to enlarge Title THE CRYSTAL STRUCTURE OF I-DMOI G20S IN COMPLEX WITH ITS TARGET DNA IN THE PRESENCE OF 2MM MG Classification HYDROLASE Compound HOMING ENDONUCLEASE I-DMOI Source Desulfurococcus mobilis (5AKM) Sequence A:  ENVSGISAYLLGLIISDGGLYKLKYKGNRSEYRVVITQKS ENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYELRVSS KKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLKR LRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVLN ISLRDRIKFVHTILSSHLNPLPP Description Functional site 1) chain A residue 111 type sequence K description BINDING SITE FOR RESIDUE ACT A 1188 source : AC1 2) chain A residue 183 type sequence N description BINDING SITE FOR RESIDUE ACT A 1188 source : AC1 3) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE ACT A 1189 source : AC2 4) chain A residue 131 type sequence N description BINDING SITE FOR RESIDUE ACT A 1189 source : AC2 5) chain A residue 21 type sequence D description BINDING SITE FOR RESIDUE MG A 1190 source : AC6 6) chain A residue 116 type sequence A description BINDING SITE FOR RESIDUE MG A 1190 source : AC6 7) chain A residue 117 type sequence E description BINDING SITE FOR RESIDUE MG A 1190 source : AC6 8) chain A residue 21 type ACT_SITE sequence D description source Swiss-Prot : SWS_FT_FI1 9) chain A residue 117 type ACT_SITE sequence E description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links