eF-site ID 5aew-S PDB Code 5aew Chain S click to enlarge Title Crystal structure of II9 variant of Biphenyl dioxygenase from Burkholderia xenovorans LB400 in complex with biphenyl Classification OXIDOREDUCTASE Compound BIPHENYL DIOXYGENASE SUBUNIT ALPHA Source (BPHE_BURXL) Sequence S:  NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRS WLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFL NQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVP FEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETY LGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQ FCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFR AAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAE QRLGHTGMPVRRMVGQHMTIFPTCSFLPGINTIRTWHPRG PNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQ DDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFP GNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP Description Functional site 1) chain S residue 100 type sequence C description BINDING SITE FOR RESIDUE FES S 460 source : CC8 2) chain S residue 102 type sequence H description BINDING SITE FOR RESIDUE FES S 460 source : CC8 3) chain S residue 103 type sequence R description BINDING SITE FOR RESIDUE FES S 460 source : CC8 4) chain S residue 120 type sequence C description BINDING SITE FOR RESIDUE FES S 460 source : CC8 5) chain S residue 122 type sequence Y description BINDING SITE FOR RESIDUE FES S 460 source : CC8 6) chain S residue 123 type sequence H description BINDING SITE FOR RESIDUE FES S 460 source : CC8 7) chain S residue 125 type sequence W description BINDING SITE FOR RESIDUE FES S 460 source : CC8 8) chain S residue 226 type sequence Q description BINDING SITE FOR RESIDUE FE2 S 461 source : CC9 9) chain S residue 233 type sequence H description BINDING SITE FOR RESIDUE FE2 S 461 source : CC9 10) chain S residue 239 type sequence H description BINDING SITE FOR RESIDUE FE2 S 461 source : CC9 11) chain S residue 388 type sequence D description BINDING SITE FOR RESIDUE FE2 S 461 source : CC9 12) chain S residue 226 type sequence Q description BINDING SITE FOR RESIDUE BNL S 462 source : DC1 13) chain S residue 230 type sequence D description BINDING SITE FOR RESIDUE BNL S 462 source : DC1 14) chain S residue 231 type sequence M description BINDING SITE FOR RESIDUE BNL S 462 source : DC1 15) chain S residue 233 type sequence H description BINDING SITE FOR RESIDUE BNL S 462 source : DC1 16) chain S residue 323 type sequence H description BINDING SITE FOR RESIDUE BNL S 462 source : DC1 17) chain S residue 333 type sequence L description BINDING SITE FOR RESIDUE BNL S 462 source : DC1 18) chain S residue 384 type sequence F description BINDING SITE FOR RESIDUE BNL S 462 source : DC1 19) chain S residue 100 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00628 source Swiss-Prot : SWS_FT_FI1 20) chain S residue 102 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU00628 source Swiss-Prot : SWS_FT_FI1 21) chain S residue 120 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00628 source Swiss-Prot : SWS_FT_FI1 22) chain S residue 123 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU00628 source Swiss-Prot : SWS_FT_FI1 23) chain S residue 233 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 24) chain S residue 239 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links