eF-site ID 5aek-L PDB Code 5aek Chain L click to enlarge Title Crystal structure of the human SENP2 C548S in complex with the human SUMO1 K48M F66W Classification HYDROLASE Compound SENTRIN-SPECIFIC PROTEASE 2 Source (SUMO1_HUMAN) Sequence L:  YIKLKVIGQDSSEIHFKVKMTTHLKKLMESYCQRQGVPMN SLRFLWEGQRIADNHTPKELGMEEEDVIEVYQEQTGG Description Functional site 1) chain L residue 37 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:25755297, ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI6 2) chain L residue 32 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI2 3) chain L residue 23 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI3 4) chain L residue 39 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI3 5) chain L residue 45 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI3 6) chain L residue 46 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI3 7) chain L residue 97 type CROSSLNK sequence G description Glycyl lysine isopeptide (Gly-Lys) (interchain with K-? in acceptor proteins) => ECO:0000269|PubMed:27068747 source Swiss-Prot : SWS_FT_FI4 8) chain L residue 25 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) source Swiss-Prot : SWS_FT_FI5 9) chain L residue 36 type SITE sequence F description Interaction with PIAS2 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links