eF-site ID 4zz9-A PDB Code 4zz9 Chain A click to enlarge Title Crystal structure of T75S mutant of Triosephosphate isomerase from Plasmodium falciparum Classification ISOMERASE Compound Triosephosphate isomerase Source Plasmodium falciparum (TPIS_PLAFA) Sequence A:  RKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVF PVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYSGEVSAEI AKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLK AVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVIL VYEPLWAIGTATPEQAQLVHKEIRKIVKDTCGEKQANQIR ILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIK SAM Description Functional site 1) chain A residue 114 type sequence Q description binding site for residue EDO A 301 source : AC1 2) chain A residue 153 type sequence L description binding site for residue EDO A 301 source : AC1 3) chain A residue 233 type sequence N description binding site for residue EDO A 301 source : AC1 4) chain A residue 236 type sequence L description binding site for residue EDO A 301 source : AC1 5) chain A residue 10 type sequence N description binding site for residue EDO A 302 source : AC2 6) chain A residue 12 type sequence K description binding site for residue EDO A 302 source : AC2 7) chain A residue 95 type sequence H description binding site for residue EDO A 302 source : AC2 8) chain A residue 230 type sequence L description binding site for residue EDO A 302 source : AC2 9) chain A residue 231 type sequence V description binding site for residue EDO A 302 source : AC2 10) chain A residue 232 type sequence G description binding site for residue EDO A 302 source : AC2 11) chain A residue 65 type sequence N description binding site for residue EDO A 303 source : AC3 12) chain A residue 66 type sequence V description binding site for residue EDO A 303 source : AC3 13) chain A residue 78 type sequence V description binding site for residue EDO A 303 source : AC3 14) chain A residue 5 type sequence Y description binding site for residue NA A 304 source : AC4 15) chain A residue 221 type sequence I description binding site for residue NA A 304 source : AC4 16) chain A residue 223 type sequence Q description binding site for residue NA A 304 source : AC4 17) chain A residue 226 type sequence I description binding site for residue NA A 304 source : AC4 18) chain A residue 232 type BINDING sequence G description BINDING => ECO:0000269|PubMed:12403619, ECO:0000269|PubMed:12454456, ECO:0000269|PubMed:14563846, ECO:0000269|PubMed:15465054, ECO:0000269|PubMed:19622869, ECO:0000312|PDB:1LZO, ECO:0007744|PDB:1LYX, ECO:0007744|PDB:1M7O, ECO:0007744|PDB:1M7P, ECO:0007744|PDB:1O5X, ECO:0007744|PDB:1WOA, ECO:0007744|PDB:2VFI source Swiss-Prot : SWS_FT_FI7 19) chain A residue 12 type BINDING sequence K description BINDING => ECO:0000269|PubMed:12403619, ECO:0000269|PubMed:15465054, ECO:0000269|PubMed:19622869, ECO:0007744|PDB:1LYX, ECO:0007744|PDB:1LZO, ECO:0007744|PDB:1WOA, ECO:0007744|PDB:2VFI source Swiss-Prot : SWS_FT_FI4 20) chain A residue 171 type BINDING sequence G description BINDING => ECO:0000269|PubMed:12403619, ECO:0000269|PubMed:19622869, ECO:0007744|PDB:1LYX, ECO:0007744|PDB:2VFI source Swiss-Prot : SWS_FT_FI5 21) chain A residue 230 type BINDING sequence L description BINDING => ECO:0000269|PubMed:12454456, ECO:0000269|PubMed:14563846, ECO:0000269|PubMed:15465054, ECO:0000269|PubMed:19622869, ECO:0007744|PDB:1M7O, ECO:0007744|PDB:1O5X, ECO:0007744|PDB:1WOA, ECO:0007744|PDB:2VFI source Swiss-Prot : SWS_FT_FI6 22) chain A residue 95 type ACT_SITE sequence H description Electrophile => ECO:0000255|PROSITE-ProRule:PRU10127 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 165 type ACT_SITE sequence E description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU10127 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 10 type BINDING sequence N description BINDING => ECO:0000269|PubMed:12454456, ECO:0000269|PubMed:14563846, ECO:0000269|PubMed:19622869, ECO:0007744|PDB:1M7O, ECO:0007744|PDB:1O5X, ECO:0007744|PDB:2VFI source Swiss-Prot : SWS_FT_FI3

Display surface Download Links