eF-site ID 4zj0-A PDB Code 4zj0 Chain A click to enlarge Title The crystal structure of monomer Q108K:K40L:Y60W CRBPII bound to all-trans-retinal Classification TRANSPORT PROTEIN Compound Retinol-binding protein 2 Source (RET2_HUMAN) Sequence A:  TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTL VIDQDGDNFKTKTTSTFRNWDVDFTVGVEFDEYTKSLDNR HVKALVTWEGDVLVCVQKGEKENRGWKKWIEGDKLYLELT CGDQVCRQVFKKK Description Functional site 1) chain A residue 60 type sequence W description binding site for residue ACT A 201 source : AC1 2) chain A residue 72 type sequence E description binding site for residue ACT A 201 source : AC1 3) chain A residue 97 type sequence Q description binding site for residue ACT A 201 source : AC1 4) chain A residue 106 type sequence W description binding site for residue ACT A 201 source : AC1 5) chain A residue 106 type sequence W description binding site for residue RET A 202 source : AC2 6) chain A residue 108 type sequence K description binding site for residue RET A 202 source : AC2 7) chain A residue 40 type BINDING sequence L description BINDING => ECO:0000269|PubMed:18076076 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 108 type BINDING sequence K description BINDING => ECO:0000269|PubMed:18076076 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 6-23 type prosite sequence GTWEMESNENFEGYMKAL description FABP Cytosolic fatty-acid binding proteins signature. GTWeMesNeNFEgYMKAL source prosite : PS00214

Display surface Download Links