eF-site ID 4zel-AB
PDB Code 4zel
Chain A, B

click to enlarge
Title Human dopamine beta-hydroxylase
Classification OXIDOREDUCTASE
Compound Dopamine beta-hydroxylase
Source Homo sapiens (Human) (DOPO_HUMAN)
Sequence A:  PLPYHIPLDPEGSLELSWNVSYTQEAIHFQLLVRRLKAGV
LFGMSDRGELENADLVVLWTDGDAYFADAWSDQKGQIHLD
PQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTV
HLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPE
LPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHI
IKYEPIVTKGNEALVHHMEVFQCAPEMDSVPHFSGPCDSK
MKPDRLNYCRHVLAAWALGAKAFYYPEEAGLAFGGPGSSR
YLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRFNAGIME
LGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHI
FASQLHTHLTGRKVVTVLVRDGREWEIVNQDNHYSPHFQE
IRMLKKVVSVHPGDVLITSCTYNTEDRELATVGGFGILEE
MCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNNED
VCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCN
KSSAVRFQGEWNLQPLPKVISTLEEPTVVS
B:  PLPYHIPLDPEGSLELSWNVSYTQEAIHFQLLVRRLKAGV
LFGMSDRGELENADLVVLAYFADAWSDQKGQIHLDPQQDY
QLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYG
ILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDA
CTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEP
IVTKGNEALVHHMEVFQCAPEVPHFSGPCDSKMLNYCRHV
LAAWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPL
VIEGRNDSSGIRLYYTAKLRRFNAGIMELGLVYTPVMAIP
PRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGR
KVVTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHP
GDVLITSCTYNTEDRELATVGGFGILEEMCVNYVHYYPQT
QLELCKSAVDAGFLQKYFHLINRFNNEDVCTCPQASVSQQ
FTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWN
LQPLPKVISTLEEPTPQCVVSIGG
Description (1)  dopamine beta hydroxylase


Functional site

1) chain A
residue 412
type
ligand
sequence H
description binding site for residue CU A 701
source : AC1

2) chain A
residue 414
type
ligand
sequence H
description binding site for residue CU A 701
source : AC1

3) chain A
residue 487
type
ligand
sequence M
description binding site for residue CU A 701
source : AC1

4) chain A
residue 47
type
ligand
sequence L
description binding site for Mono-Saccharide NAG A 702 bound to ASN A 64
source : AC2

5) chain A
residue 64
type
ligand
sequence N
description binding site for Mono-Saccharide NAG A 702 bound to ASN A 64
source : AC2

6) chain A
residue 65
type
ligand
sequence V
description binding site for Mono-Saccharide NAG A 702 bound to ASN A 64
source : AC2

7) chain A
residue 177
type
ligand
sequence F
description binding site for Poly-Saccharide residues NAG A 705 through BMA A 707 bound to ASN A 184
source : AC3

8) chain A
residue 184
type
ligand
sequence N
description binding site for Poly-Saccharide residues NAG A 705 through BMA A 707 bound to ASN A 184
source : AC3

9) chain A
residue 186
type
ligand
sequence S
description binding site for Poly-Saccharide residues NAG A 705 through BMA A 707 bound to ASN A 184
source : AC3

10) chain B
residue 570
type
ligand
sequence A
description binding site for Poly-Saccharide residues NAG A 705 through BMA A 707 bound to ASN A 184
source : AC3

11) chain B
residue 571
type
ligand
sequence V
description binding site for Poly-Saccharide residues NAG A 705 through BMA A 707 bound to ASN A 184
source : AC3

12) chain A
residue 370
type
ligand
sequence V
description binding site for Poly-Saccharide residues NAG A 703 through NAG A 704 bound to ASN A 566
source : AC4

13) chain A
residue 502
type
ligand
sequence L
description binding site for Poly-Saccharide residues NAG A 703 through NAG A 704 bound to ASN A 566
source : AC4

14) chain A
residue 564
type
ligand
sequence H
description binding site for Poly-Saccharide residues NAG A 703 through NAG A 704 bound to ASN A 566
source : AC4

15) chain A
residue 566
type
ligand
sequence N
description binding site for Poly-Saccharide residues NAG A 703 through NAG A 704 bound to ASN A 566
source : AC4

16) chain A
residue 570
type
ligand
sequence A
description binding site for Poly-Saccharide residues NAG A 703 through NAG A 704 bound to ASN A 566
source : AC4

17) chain A
residue 572
type
ligand
sequence R
description binding site for Poly-Saccharide residues NAG A 703 through NAG A 704 bound to ASN A 566
source : AC4

18) chain B
residue 64
type
ligand
sequence N
description binding site for Mono-Saccharide NAG B 705 bound to ASN B 64
source : AC5

19) chain B
residue 65
type
ligand
sequence V
description binding site for Mono-Saccharide NAG B 705 bound to ASN B 64
source : AC5

20) chain B
residue 206
type
ligand
sequence E
description binding site for Mono-Saccharide NAG B 705 bound to ASN B 64
source : AC5

21) chain A
residue 92
type
ligand
sequence R
description binding site for Poly-Saccharide residues NAG B 701 through MAN B 704 bound to ASN B 344
source : AC6

22) chain A
residue 185
type
ligand
sequence G
description binding site for Poly-Saccharide residues NAG B 701 through MAN B 704 bound to ASN B 344
source : AC6

23) chain A
residue 190
type
ligand
sequence M
description binding site for Poly-Saccharide residues NAG B 701 through MAN B 704 bound to ASN B 344
source : AC6

24) chain A
residue 418
type
ligand
sequence R
description binding site for Poly-Saccharide residues NAG B 701 through MAN B 704 bound to ASN B 344
source : AC6

25) chain A
residue 469
type
ligand
sequence N
description binding site for Poly-Saccharide residues NAG B 701 through MAN B 704 bound to ASN B 344
source : AC6

26) chain A
residue 471
type
ligand
sequence E
description binding site for Poly-Saccharide residues NAG B 701 through MAN B 704 bound to ASN B 344
source : AC6

27) chain B
residue 220
type
ligand
sequence N
description binding site for Poly-Saccharide residues NAG B 701 through MAN B 704 bound to ASN B 344
source : AC6

28) chain B
residue 221
type
ligand
sequence I
description binding site for Poly-Saccharide residues NAG B 701 through MAN B 704 bound to ASN B 344
source : AC6

29) chain B
residue 344
type
ligand
sequence N
description binding site for Poly-Saccharide residues NAG B 701 through MAN B 704 bound to ASN B 344
source : AC6

30) chain B
residue 502
type
ligand
sequence L
description binding site for Poly-Saccharide residues NAG B 706 through BMA B 708 bound to ASN B 566
source : AC7

31) chain B
residue 564
type
ligand
sequence H
description binding site for Poly-Saccharide residues NAG B 706 through BMA B 708 bound to ASN B 566
source : AC7

32) chain B
residue 566
type
ligand
sequence N
description binding site for Poly-Saccharide residues NAG B 706 through BMA B 708 bound to ASN B 566
source : AC7

33) chain B
residue 569
type
ligand
sequence S
description binding site for Poly-Saccharide residues NAG B 706 through BMA B 708 bound to ASN B 566
source : AC7

34) chain B
residue 570
type
ligand
sequence A
description binding site for Poly-Saccharide residues NAG B 706 through BMA B 708 bound to ASN B 566
source : AC7

35) chain B
residue 571
type
ligand
sequence V
description binding site for Poly-Saccharide residues NAG B 706 through BMA B 708 bound to ASN B 566
source : AC7

36) chain B
residue 572
type
ligand
sequence R
description binding site for Poly-Saccharide residues NAG B 706 through BMA B 708 bound to ASN B 566
source : AC7

37) chain A
residue 191
type ACT_SITE
ligand
sequence G
description {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI1

38) chain A
residue 373
type ACT_SITE
ligand
sequence P
description {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI1

39) chain A
residue 223
type METAL
ligand
sequence I
description Copper A. {ECO:0000250}
source Swiss-Prot : SWS_FT_FI2

40) chain A
residue 224
type METAL
ligand
sequence P
description Copper A. {ECO:0000250}
source Swiss-Prot : SWS_FT_FI2

41) chain A
residue 294
type METAL
ligand
sequence Y
description Copper A. {ECO:0000250}
source Swiss-Prot : SWS_FT_FI2

42) chain A
residue 373
type METAL
ligand
sequence P
description Copper B. {ECO:0000250}
source Swiss-Prot : SWS_FT_FI3

43) chain A
residue 375
type METAL
ligand
sequence M
description Copper B. {ECO:0000250}
source Swiss-Prot : SWS_FT_FI3

44) chain A
residue 448
type METAL
ligand
sequence R
description Copper B. {ECO:0000250}
source Swiss-Prot : SWS_FT_FI3

45) chain B
residue 191
type ACT_SITE
ligand
sequence G
description {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI5

46) chain B
residue 373
type ACT_SITE
ligand
sequence P
description {ECO:0000255}.
source Swiss-Prot : SWS_FT_FI5

47) chain B
residue 223
type METAL
ligand
sequence I
description Copper A. {ECO:0000250}
source Swiss-Prot : SWS_FT_FI6

48) chain B
residue 224
type METAL
ligand
sequence P
description Copper A. {ECO:0000250}
source Swiss-Prot : SWS_FT_FI6

49) chain B
residue 294
type METAL
ligand
sequence Y
description Copper A. {ECO:0000250}
source Swiss-Prot : SWS_FT_FI6

50) chain B
residue 373
type METAL
ligand
sequence P
description Copper B. {ECO:0000250}
source Swiss-Prot : SWS_FT_FI7

51) chain B
residue 375
type METAL
ligand
sequence M
description Copper B. {ECO:0000250}
source Swiss-Prot : SWS_FT_FI7

52) chain B
residue 448
type METAL
ligand
sequence R
description Copper B. {ECO:0000250}
source Swiss-Prot : SWS_FT_FI7

53) chain A
residue 47-48
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence LP
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_702

54) chain A
residue 64-66
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence NVS
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_702

55) chain A
residue 73
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence H
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_702

56) chain A
residue 146
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_702

57) chain A
residue 175
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence E
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_705

58) chain A
residue 177
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence F
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_705

59) chain A
residue 182
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence A
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_705

60) chain A
residue 184
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_705

61) chain A
residue 186
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence S
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_705

62) chain A
residue 296
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence R
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_703

63) chain A
residue 370
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence V
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_703

64) chain A
residue 502
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_703

65) chain A
residue 564
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence H
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_703

66) chain A
residue 566
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_703

67) chain A
residue 570-572
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence AVR
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_A_703

68) chain B
residue 47
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_B_705

69) chain B
residue 64-65
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence NV
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_B_705

70) chain B
residue 73
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence H
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_B_705

71) chain B
residue 146
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_B_705

72) chain B
residue 219-222
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence PNIQ
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_B_701

73) chain B
residue 344
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_B_701

74) chain B
residue 370
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence V
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_B_706

75) chain B
residue 502
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence L
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_B_706

76) chain B
residue 564
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence H
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_B_706

77) chain B
residue 566
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence N
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_B_706

78) chain B
residue 569-572
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence SAVR
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_B_706

79) chain B
residue 569-570
type binding
ligand NAG: N-ACETYL-D-GLUCOSAMINE
sequence SA
description N-ACETYL-D-GLUCOSAMINE binding site
source pdb_hetatom : NAG_4zel_B_707


Display surface

Download
Links