eF-site ID 4zbj-ABC
PDB Code 4zbj
Chain A, B, C

click to enlarge
Title UBN1 peptide bound to H3.3/H4/Asf1
Classification STRUCTURAL PROTEIN
Compound Histone chaperone ASF1
Source (UBN1_HUMAN)
Sequence A:  PLGSPNSSIVSLLGIKVLNNPAKFTDPYEFEITFECLESL
KHDLEWKLTYVGSSRSLDHDQELDSILVGPVPVGVNKFVF
SADPPSAELIPASELVSVTVILLSCSYDGREFVRVGYYVN
NEYDEEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWD
B:  ALIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAY
LVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
C:  VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKV
FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGF
GG
Description (1)  Anti-silencing protein 1 , Histone H3, Histone H4 , Ubinuclein-1


Functional site

1) chain A
residue 5
type
ligand
sequence S
description binding site for residue CL A 201
source : AC1

2) chain A
residue 6
type
ligand
sequence L
description binding site for residue CL A 201
source : AC1

3) chain A
residue 148
type
ligand
sequence R
description binding site for residue CL A 201
source : AC1

4) chain A
residue 116
type
ligand
sequence E
description binding site for residue CL A 202
source : AC2

5) chain A
residue 117
type
ligand
sequence Y
description binding site for residue CL A 202
source : AC2

6) chain A
residue 141
type
ligand
sequence A
description binding site for residue CL A 203
source : AC3

7) chain A
residue 142
type
ligand
sequence E
description binding site for residue CL A 203
source : AC3

8) chain A
residue 21
type
ligand
sequence P
description binding site for residue MPD A 204
source : AC4

9) chain A
residue 78
type
ligand
sequence P
description binding site for residue MPD A 204
source : AC4

10) chain B
residue 60
type
ligand
sequence A
description binding site for residue MPD A 204
source : AC4

11) chain C
residue 36
type
ligand
sequence R
description binding site for residue MPD A 204
source : AC4

12) chain A
residue 91
type
ligand
sequence S
description binding site for residue CL B 201
source : AC5

13) chain A
residue 92
type
ligand
sequence V
description binding site for residue CL B 201
source : AC5

14) chain B
residue 116
type
ligand
sequence R
description binding site for residue CL B 201
source : AC5

15) chain B
residue 122
type
ligand
sequence K
description binding site for residue CL B 201
source : AC5

16) chain B
residue 63
type
ligand
sequence R
description binding site for residue CL B 202
source : AC6

17) chain C
residue 36
type
ligand
sequence R
description binding site for residue CL B 202
source : AC6

18) chain B
residue 121
type
ligand
sequence P
description binding site for residue CL B 203
source : AC7

19) chain B
residue 122
type
ligand
sequence K
description binding site for residue CL B 203
source : AC7

20) chain B
residue 63
type
ligand
sequence R
description binding site for residue CL B 204
source : AC8

21) chain B
residue 64
type
ligand
sequence K
description binding site for residue CL B 204
source : AC8

22) chain A
residue 75
type
ligand
sequence S
description binding site for residue CL C 201
source : AC9

23) chain C
residue 35
type
ligand
sequence R
description binding site for residue CL C 201
source : AC9

24) chain B
residue 66-74
type prosite
ligand
sequence PFQRLVREI
description Histone H3 signature 2.P-F-x-[RA]-L-[VA]-[KRQ]-[DEG]-[IV].
source prosite : PS00959


Display surface

Download
Links