eF-site ID 4z7y-A PDB Code 4z7y Chain A click to enlarge Title diphosphomevalonate decarboxylase from the Sulfolobus solfataricus, space group P21 Classification LYASE Compound Diphosphomevalonate decarboxylase Source (DMD_SULSO) Sequence A:  LKSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDD QLSVITKVTLNDKNIVIVNDRILSEDEMKEYAGRVLDTFK KIVGKEFHVKVESKSKFPINAGLASSAAGIAALAFSLNEL LELNLKSEELSKIARLGSGSACRSMFGGFVVWNKGEREDG EDSYCYQIFRHDYWSELVDIIPILSEKEKKISSRKGMIRS AETSELMECRLKYIEKTFNEVIEAIRNRDEKKFYYLMMRH SNSMHAVILDSWPSFFYLNDTSIRIMEWIHDYGKAGYTFD AGPNPHIFTTERNIGDILEFLKSLEIKRIIVSKVGDGPKV LSRE Description Functional site 1) chain A residue 148 type sequence G description binding site for residue SO4 A 401 source : AC1 2) chain A residue 149 type sequence G description binding site for residue SO4 A 401 source : AC1 3) chain A residue 168 type sequence Q description binding site for residue SO4 A 401 source : AC1 4) chain A residue 172 type sequence H description binding site for residue SO4 A 401 source : AC1 5) chain A residue 317 type sequence D description binding site for residue SO4 A 401 source : AC1 6) chain A residue 318 type sequence G description binding site for residue SO4 A 401 source : AC1 7) chain A residue 18 type BINDING sequence Y description BINDING => ECO:0000250|UniProtKB:O23722 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 75 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:O23722 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 139 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:O23722 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 121-128 type prosite sequence LLELNLKS description CPSASE_2 Carbamoyl-phosphate synthase subdomain signature 2. LLELNLKS source prosite : PS00867

Display surface Download Links