eF-site ID 4z2m-J PDB Code 4z2m Chain J click to enlarge Title Crystal structure of human SPT16 Mid-AID/H3-H4 tetramer FACT Histone complex Classification Transcription/DNA binding protein Compound FACT complex subunit SPT16 Source (H4_HUMAN) Sequence J:  DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLE NVIRDAVTYTEHAKRKTVTAMDVVYALKRQ Description Functional site 1) chain J residue 91 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000269|PubMed:19818714 source Swiss-Prot : SWS_FT_FI15 2) chain J residue 59 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI16 3) chain J residue 79 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate => ECO:0007744|PubMed:28112733 source Swiss-Prot : SWS_FT_FI16 4) chain J residue 31 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in UFM1); alternate => ECO:0000269|PubMed:30886146 source Swiss-Prot : SWS_FT_FI17 5) chain J residue 44 type MOD_RES sequence K description N6-propionyllysine; alternate => ECO:0000269|PubMed:17267393 source Swiss-Prot : SWS_FT_FI5 6) chain J residue 31 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI6 7) chain J residue 77 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI6 8) chain J residue 91 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435 source Swiss-Prot : SWS_FT_FI6 9) chain J residue 47 type MOD_RES sequence S description Phosphoserine; by PAK2 => ECO:0000269|PubMed:21724829, ECO:0007744|PubMed:17081983, ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:19690332, ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI8 10) chain J residue 51 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:15592455, ECO:0007744|PubMed:20068231 source Swiss-Prot : SWS_FT_FI9 11) chain J residue 59 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000269|PubMed:31542297 source Swiss-Prot : SWS_FT_FI10 12) chain J residue 79 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P62806 source Swiss-Prot : SWS_FT_FI11 13) chain J residue 80 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:P62806 source Swiss-Prot : SWS_FT_FI12 14) chain J residue 88 type MOD_RES sequence Y description Phosphotyrosine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI13

Display surface Download Links