eF-site ID 4yno-A PDB Code 4yno Chain A click to enlarge Title Crystal structure of MAPK13 at INACTIVE FORM Classification TRANSFERASE Compound Mitogen-activated protein kinase 13 Source (MK13_HUMAN) Sequence A:  SLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCS AIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQH ENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGME FSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNED CELKILDFGLAGYVVTRWYRAPEVILSWMHYNQTVDIWSV GCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQK LNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKML ELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLE HEKLTVDEWKQHIYKEIVNFSP Description Functional site 1) chain A residue 47 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18088087 source Swiss-Prot : SWS_FT_FI3 2) chain A residue 182 type MOD_RES sequence Y description Phosphotyrosine; by MAP2K3, MAP2K4, MAP2K6 and MAP2K7 => ECO:0000269|PubMed:9374491 source Swiss-Prot : SWS_FT_FI5 3) chain A residue 350 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:19369195 source Swiss-Prot : SWS_FT_FI6 4) chain A residue 31-55 type prosite sequence VGSGAYGSVCSAIDKRSGEKVAIKK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. VGSGAYGSVCsAidkrsgekv.........AIKK source prosite : PS00107 5) chain A residue 60-162 type prosite sequence FQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRN FYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLK YIHSAGVVHRDLKPGNLAVNEDC description MAPK MAP kinase signature. FqseifakrayREllllkhmqhenviglldvftpasslrnfydfylvmpfmqtdlqkimgmefseekiqylvyqmlkglkyihsagvvh..........RDlKpgnlavnedC source prosite : PS01351 6) chain A residue 150 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 31 type BINDING sequence V description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 8) chain A residue 54 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links