eF-site ID 4ykm-B PDB Code 4ykm Chain B click to enlarge Title Crystal structure of the R111K:Y134F:T54V:R132Q:P39Q:R59Y:A32W:F3Q mutant of human Cellular Retinoic Acid Binding Protein II with Retinal at 1.58 angstrom resolution Classification TRANSPORT PROTEIN Compound Cellular retinoic acid-binding protein 2 Source Homo sapiens (Human) (RABP2_HUMAN) Sequence B:  PNQSGNWKIIRSENFEELLKVLGVNVMLRKIWVAAASKQA VEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELI LTMTADDVVCTQVFVRE Description Functional site 1) chain B residue 3 type sequence Q description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 2) chain B residue 32 type sequence W description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 3) chain B residue 52 type sequence I description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 4) chain B residue 54 type sequence V description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 5) chain B residue 56 type sequence T description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 6) chain B residue 59 type sequence Y description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 7) chain B residue 76 type sequence V description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 8) chain B residue 92 type sequence K description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 9) chain B residue 93 type sequence M description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 10) chain B residue 109 type sequence W description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 11) chain B residue 110 type sequence T description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 12) chain B residue 112 type sequence E description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 13) chain B residue 119 type sequence L description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 14) chain B residue 120 type sequence I description binding site for Di-peptide RET B 201 and LYS B 111 source : AC2 15) chain B residue 132 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:16979656, ECO:0007744|PDB:2FR3 source Swiss-Prot : SWS_FT_FI1 16) chain B residue 101 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) => ECO:0000269|PubMed:21998312 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links