eF-site ID 4yhz-L PDB Code 4yhz Chain L click to enlarge Title Crystal structure of 304M3-B Fab in complex with H3K4me3 peptide Classification IMMUNE SYSTEM Compound Fab Heavy Chain Source (4YHZ) Sequence L:  LTQPPSVSVAPGQTARITCGGTNIGDISVHWYQQRPGQAP LVVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEA DYYCQVWDDSINAYVFGTGTKVTVLRTVAAPSVFIFPPSD SQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQES VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS SPVTKSFNRGE Description Functional site 1) chain L residue 36 type sequence Q description binding site for residue GOL L 301 source : AC6 2) chain L residue 38 type sequence R description binding site for residue GOL L 301 source : AC6 3) chain L residue 57 type sequence I description binding site for residue GOL L 301 source : AC6 4) chain L residue 58 type sequence P description binding site for residue GOL L 301 source : AC6 5) chain L residue 61 type sequence F description binding site for residue GOL L 301 source : AC6 6) chain L residue 80 type sequence G description binding site for residue GOL L 301 source : AC6 7) chain L residue 81 type sequence D description binding site for residue GOL L 301 source : AC6 8) chain L residue 58 type sequence P description binding site for residue GOL L 302 source : AC7 9) chain L residue 59 type sequence E description binding site for residue GOL L 302 source : AC7 10) chain L residue 60 type sequence R description binding site for residue GOL L 302 source : AC7 11) chain L residue 76 type sequence R description binding site for residue GOL L 302 source : AC7 12) chain L residue 67 type sequence G description binding site for residue SO4 L 303 source : AC8 13) chain L residue 68 type sequence N description binding site for residue SO4 L 303 source : AC8 14) chain L residue 69 type sequence T description binding site for residue SO4 L 303 source : AC8 15) chain L residue 29 type sequence D description binding site for Ligand residues M3L P 4 through GLN P 5 bound to THR P 3 source : AC9 16) chain L residue 90 type sequence W description binding site for Ligand residues M3L P 4 through GLN P 5 bound to THR P 3 source : AC9 17) chain L residue 97 type sequence Y description binding site for Ligand residues M3L P 4 through GLN P 5 bound to THR P 3 source : AC9 18) chain L residue 14-25 type prosite sequence PGQTARITCGGT description AA_TRNA_LIGASE_I Aminoacyl-transfer RNA synthetases class-I signature. PgqTArITCGGT source prosite : PS00178 19) chain L residue 193-199 type prosite sequence YACEVTH description IG_MHC Immunoglobulins and major histocompatibility complex proteins signature. YICNVNH source prosite : PS00290

Display surface Download Links