eF-site ID 4yhz-L
PDB Code 4yhz
Chain L

click to enlarge
Title Crystal structure of 304M3-B Fab in complex with H3K4me3 peptide
Classification IMMUNE SYSTEM
Compound Fab Heavy Chain
Source (4YHZ)
Sequence L:  LTQPPSVSVAPGQTARITCGGTNIGDISVHWYQQRPGQAP
LVVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEA
DYYCQVWDDSINAYVFGTGTKVTVLRTVAAPSVFIFPPSD
SQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQES
VTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLS
SPVTKSFNRGE
Description (1)  Fab Heavy Chain, Fab Light Chain, H3K4me3 peptide


Functional site

1) chain L
residue 36
type
ligand
sequence Q
description binding site for residue GOL L 301
source : AC6

2) chain L
residue 38
type
ligand
sequence R
description binding site for residue GOL L 301
source : AC6

3) chain L
residue 57
type
ligand
sequence I
description binding site for residue GOL L 301
source : AC6

4) chain L
residue 58
type
ligand
sequence P
description binding site for residue GOL L 301
source : AC6

5) chain L
residue 61
type
ligand
sequence F
description binding site for residue GOL L 301
source : AC6

6) chain L
residue 80
type
ligand
sequence G
description binding site for residue GOL L 301
source : AC6

7) chain L
residue 81
type
ligand
sequence D
description binding site for residue GOL L 301
source : AC6

8) chain L
residue 58
type
ligand
sequence P
description binding site for residue GOL L 302
source : AC7

9) chain L
residue 59
type
ligand
sequence E
description binding site for residue GOL L 302
source : AC7

10) chain L
residue 60
type
ligand
sequence R
description binding site for residue GOL L 302
source : AC7

11) chain L
residue 76
type
ligand
sequence R
description binding site for residue GOL L 302
source : AC7

12) chain L
residue 67
type
ligand
sequence G
description binding site for residue SO4 L 303
source : AC8

13) chain L
residue 68
type
ligand
sequence N
description binding site for residue SO4 L 303
source : AC8

14) chain L
residue 69
type
ligand
sequence T
description binding site for residue SO4 L 303
source : AC8

15) chain L
residue 29
type
ligand
sequence D
description binding site for Ligand residues M3L P 4 through GLN P 5 bound to THR P 3
source : AC9

16) chain L
residue 90
type
ligand
sequence W
description binding site for Ligand residues M3L P 4 through GLN P 5 bound to THR P 3
source : AC9

17) chain L
residue 97
type
ligand
sequence Y
description binding site for Ligand residues M3L P 4 through GLN P 5 bound to THR P 3
source : AC9

18) chain L
residue 90
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence W
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4yhz_P_4

19) chain L
residue 97
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence Y
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4yhz_P_4

20) chain L
residue 36
type binding
ligand GOL: GLYCEROL
sequence Q
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_L_301

21) chain L
residue 38
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_L_301

22) chain L
residue 44
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_L_301

23) chain L
residue 46
type binding
ligand GOL: GLYCEROL
sequence V
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_L_301

24) chain L
residue 57-58
type binding
ligand GOL: GLYCEROL
sequence IP
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_L_301

25) chain L
residue 60-61
type binding
ligand GOL: GLYCEROL
sequence RF
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_L_301

26) chain L
residue 80-81
type binding
ligand GOL: GLYCEROL
sequence GD
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_L_301

27) chain L
residue 85
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_L_301

28) chain L
residue 58-60
type binding
ligand GOL: GLYCEROL
sequence PER
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_L_302

29) chain L
residue 76
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_L_302


Display surface

Download
Links