eF-site ID 4yhz-H
PDB Code 4yhz
Chain H

click to enlarge
Title Crystal structure of 304M3-B Fab in complex with H3K4me3 peptide
Classification IMMUNE SYSTEM
Compound Fab Heavy Chain
Source (4YHZ)
Sequence H:  EVQLVETGGGVVQPGRSLRLSCTASGFTFRDYWMSWVRQA
PGKGLEWVADIHQDGQVRYYLDAVKGRFTISRDNAKSSLY
LQMNSLGAEDTAVYYCARNFVRGFGWHFDLWGRGTLVTVS
SASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC
NVNHKPSNTKVDKKVEPKS
Description (1)  Fab Heavy Chain, Fab Light Chain, H3K4me3 peptide


Functional site

1) chain H
residue 31
type
ligand
sequence D
description binding site for residue GOL H 301
source : AC1

2) chain H
residue 32
type
ligand
sequence Y
description binding site for residue GOL H 301
source : AC1

3) chain H
residue 53
type
ligand
sequence Q
description binding site for residue GOL H 301
source : AC1

4) chain H
residue 100
type
ligand
sequence F
description binding site for residue GOL H 301
source : AC1

5) chain H
residue 100
type
ligand
sequence F
description binding site for residue GOL H 301
source : AC1

6) chain H
residue 101
type
ligand
sequence V
description binding site for residue GOL H 301
source : AC1

7) chain H
residue 101
type
ligand
sequence V
description binding site for residue GOL H 301
source : AC1

8) chain H
residue 102
type
ligand
sequence R
description binding site for residue GOL H 301
source : AC1

9) chain H
residue 106
type
ligand
sequence W
description binding site for residue GOL H 301
source : AC1

10) chain H
residue 104
type
ligand
sequence F
description binding site for residue GOL H 302
source : AC2

11) chain H
residue 106
type
ligand
sequence W
description binding site for residue GOL H 302
source : AC2

12) chain H
residue 106
type
ligand
sequence W
description binding site for residue GOL H 302
source : AC2

13) chain H
residue 30
type
ligand
sequence R
description binding site for residue GOL H 303
source : AC3

14) chain H
residue 73
type
ligand
sequence D
description binding site for residue GOL H 303
source : AC3

15) chain H
residue 74
type
ligand
sequence N
description binding site for residue GOL H 303
source : AC3

16) chain H
residue 75
type
ligand
sequence A
description binding site for residue GOL H 303
source : AC3

17) chain H
residue 27
type
ligand
sequence F
description binding site for residue GOL H 304
source : AC4

18) chain H
residue 98
type
ligand
sequence R
description binding site for residue GOL H 304
source : AC4

19) chain H
residue 16
type
ligand
sequence R
description binding site for residue GOL H 305
source : AC5

20) chain H
residue 17
type
ligand
sequence S
description binding site for residue GOL H 305
source : AC5

21) chain H
residue 33
type
ligand
sequence W
description binding site for Ligand residues M3L P 4 through GLN P 5 bound to THR P 3
source : AC9

22) chain H
residue 50
type
ligand
sequence D
description binding site for Ligand residues M3L P 4 through GLN P 5 bound to THR P 3
source : AC9

23) chain H
residue 103
type
ligand
sequence G
description binding site for Ligand residues M3L P 4 through GLN P 5 bound to THR P 3
source : AC9

24) chain H
residue 106
type
ligand
sequence W
description binding site for Ligand residues M3L P 4 through GLN P 5 bound to THR P 3
source : AC9

25) chain H
residue 2
type binding
ligand GOL: GLYCEROL
sequence V
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_H_304

26) chain H
residue 26-27
type binding
ligand GOL: GLYCEROL
sequence GF
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_H_304

27) chain H
residue 32
type binding
ligand GOL: GLYCEROL
sequence Y
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_H_304

28) chain H
residue 98
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_H_304

29) chain H
residue 109
type binding
ligand GOL: GLYCEROL
sequence D
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_H_304

30) chain H
residue 15-17
type binding
ligand GOL: GLYCEROL
sequence GRS
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_H_305

31) chain H
residue 30
type binding
ligand GOL: GLYCEROL
sequence R
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_H_303

32) chain H
residue 72-75
type binding
ligand GOL: GLYCEROL
sequence RDNA
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_H_303

33) chain H
residue 31-33
type binding
ligand GOL: GLYCEROL
sequence DYW
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_H_301

34) chain H
residue 53
type binding
ligand GOL: GLYCEROL
sequence Q
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_H_301

35) chain H
residue 99-101
type binding
ligand GOL: GLYCEROL
sequence NFV
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_H_301

36) chain H
residue 106
type binding
ligand GOL: GLYCEROL
sequence W
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_H_301

37) chain H
residue 33
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence W
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4yhz_P_4

38) chain H
residue 50
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence D
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4yhz_P_4

39) chain H
residue 59
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence Y
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4yhz_P_4

40) chain H
residue 99
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence N
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4yhz_P_4

41) chain H
residue 106
type binding
ligand M3L: N-TRIMETHYLLYSINE
sequence W
description N-TRIMETHYLLYSINE binding site
source pdb_hetatom : M3L_4yhz_P_4

42) chain H
residue 106
type binding
ligand GOL: GLYCEROL
sequence W
description GLYCEROL binding site
source pdb_hetatom : GOL_4yhz_H_302


Display surface

Download
Links