eF-site ID 4ygz-A PDB Code 4ygz Chain A click to enlarge Title CRYSTAL STRUCTURE OF THE R111K:Y134F:T54V:R132Q:P39Y:R59Y MUTANT OF HUMAN CELLULAR RETINOIC ACID BINDING PROTEIN II WITH RETINAL AT 2.06 ANGSTROM RESOLUTION - VISIBLE LIGHT IRRADIATED CRYSTAL -3RD CYCLE Classification TRANSPORT PROTEIN Compound Cellular retinoic acid-binding protein 2 Source Homo sapiens (Human) (RABP2_HUMAN) Sequence A:  PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYA VEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELI LTMTADDVVCTQVFVRE Description Functional site 1) chain A residue 15 type sequence F description binding site for residue RET A 201 source : AC1 2) chain A residue 27 type sequence M description binding site for residue RET A 201 source : AC1 3) chain A residue 31 type sequence I description binding site for residue RET A 201 source : AC1 4) chain A residue 39 type sequence Y description binding site for residue RET A 201 source : AC1 5) chain A residue 56 type sequence T description binding site for residue RET A 201 source : AC1 6) chain A residue 76 type sequence V description binding site for residue RET A 201 source : AC1 7) chain A residue 111 type sequence K description binding site for residue RET A 201 source : AC1 8) chain A residue 123 type sequence M description binding site for residue RET A 201 source : AC1 9) chain A residue 132 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:16979656, ECO:0007744|PDB:2FR3 source Swiss-Prot : SWS_FT_FI1 10) chain A residue 5-22 type prosite sequence GNWKIIRSENFEELLKVL description FABP Cytosolic fatty-acid binding proteins signature. GNWkIirSeNFEeLLKVL source prosite : PS00214 11) chain A residue 101 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) => ECO:0000269|PubMed:21998312 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links