eF-site ID 4y7w-V PDB Code 4y7w Chain V click to enlarge Title Yeast 20S proteasome in complex with Ac-LAE-ep Classification HYDROLASE/HYDROLASE INHIBITOR Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae; Sequence V:  TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPK IWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSAL QMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTD VGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQ AGIWNDLGSGSNVDVCVMEIGKDAEYLRNYLTPNVREEKQ KSYKFPRGTTAVLKESIVNICD Description Functional site 1) chain V residue 162 type sequence G description binding site for residue MG L 301 source : AC9 2) chain V residue 163 type sequence I description binding site for residue MG L 301 source : AC9 3) chain V residue 166 type sequence D description binding site for residue MG L 301 source : AC9 4) chain V residue 169 type sequence S description binding site for residue MG L 301 source : AC9 5) chain V residue 69 type sequence Y description binding site for residue CL U 301 source : AD2 6) chain V residue 47 type sequence G description binding site for residue MES V 301 source : AD3 7) chain V residue 48 type sequence T description binding site for residue MES V 301 source : AD3 8) chain V residue 128 type sequence G description binding site for residue MES V 301 source : AD3 9) chain V residue 129 type sequence S description binding site for residue MES V 301 source : AD3 10) chain V residue 1 type sequence T description binding site for Ligand residues POL f 5 through ALA f 3 bound to THR V 1 source : AE2 11) chain V residue 19 type sequence R description binding site for Ligand residues POL f 5 through ALA f 3 bound to THR V 1 source : AE2 12) chain V residue 20 type sequence S description binding site for Ligand residues POL f 5 through ALA f 3 bound to THR V 1 source : AE2 13) chain V residue 21 type sequence T description binding site for Ligand residues POL f 5 through ALA f 3 bound to THR V 1 source : AE2 14) chain V residue 33 type sequence K description binding site for Ligand residues POL f 5 through ALA f 3 bound to THR V 1 source : AE2 15) chain V residue 45 type sequence G description binding site for Ligand residues POL f 5 through ALA f 3 bound to THR V 1 source : AE2 16) chain V residue 47 type sequence G description binding site for Ligand residues POL f 5 through ALA f 3 bound to THR V 1 source : AE2 17) chain V residue 52 type sequence T description binding site for Ligand residues POL f 5 through ALA f 3 bound to THR V 1 source : AE2 18) chain V residue 168 type sequence G description binding site for Ligand residues POL f 5 through ALA f 3 bound to THR V 1 source : AE2 19) chain V residue 1 type sequence T description binding site for Ligand GAU f 4 bound to THR V 1 source : AE3 20) chain V residue 33 type sequence K description binding site for Ligand GAU f 4 bound to THR V 1 source : AE3 21) chain V residue 45 type sequence G description binding site for Ligand GAU f 4 bound to THR V 1 source : AE3 22) chain V residue 47 type sequence G description binding site for Ligand GAU f 4 bound to THR V 1 source : AE3 23) chain V residue 52 type sequence T description binding site for Ligand GAU f 4 bound to THR V 1 source : AE3 24) chain V residue 21 type sequence T description binding site for Di-peptide ACE f 1 and LEU f 2 source : AF2 25) chain V residue 22 type sequence Q description binding site for Di-peptide ACE f 1 and LEU f 2 source : AF2 26) chain V residue 49 type sequence A description binding site for Di-peptide ACE f 1 and LEU f 2 source : AF2 27) chain V residue 114 type sequence H description binding site for Di-peptide ACE h 1 and LEU h 2 source : AF4 28) chain V residue 118 type sequence S description binding site for Di-peptide ACE h 1 and LEU h 2 source : AF4 29) chain V residue 1 type catalytic sequence T description 177 source MCSA : MCSA2 30) chain V residue 17 type catalytic sequence D description 177 source MCSA : MCSA2 31) chain V residue 19 type catalytic sequence R description 177 source MCSA : MCSA2 32) chain V residue 33 type catalytic sequence K description 177 source MCSA : MCSA2 33) chain V residue 47 type catalytic sequence G description 177 source MCSA : MCSA2 34) chain V residue 129 type catalytic sequence S description 177 source MCSA : MCSA2 35) chain V residue 166 type catalytic sequence D description 177 source MCSA : MCSA2 36) chain V residue 169 type catalytic sequence S description 177 source MCSA : MCSA2

Display surface Download Links