eF-site ID 4y7w-b PDB Code 4y7w Chain b click to enlarge Title Yeast 20S proteasome in complex with Ac-LAE-ep Classification HYDROLASE/HYDROLASE INHIBITOR Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae; Sequence b:  TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDK IWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAAS VFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVH KLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLS QAIKWDGSSGGVIRMVVLTAAGVERLIFYPDEYEQL Description Functional site 1) chain b residue 1 type sequence T description binding site for Ligand residues POL h 5 through ALA h 3 bound to THR b 1 source : AE6 2) chain b residue 19 type sequence R description binding site for Ligand residues POL h 5 through ALA h 3 bound to THR b 1 source : AE6 3) chain b residue 20 type sequence T description binding site for Ligand residues POL h 5 through ALA h 3 bound to THR b 1 source : AE6 4) chain b residue 21 type sequence T description binding site for Ligand residues POL h 5 through ALA h 3 bound to THR b 1 source : AE6 5) chain b residue 31 type sequence T description binding site for Ligand residues POL h 5 through ALA h 3 bound to THR b 1 source : AE6 6) chain b residue 45 type sequence R description binding site for Ligand residues POL h 5 through ALA h 3 bound to THR b 1 source : AE6 7) chain b residue 47 type sequence G description binding site for Ligand residues POL h 5 through ALA h 3 bound to THR b 1 source : AE6 8) chain b residue 49 type sequence A description binding site for Ligand residues POL h 5 through ALA h 3 bound to THR b 1 source : AE6 9) chain b residue 129 type sequence S description binding site for Ligand residues POL h 5 through ALA h 3 bound to THR b 1 source : AE6 10) chain b residue 168 type sequence S description binding site for Ligand residues POL h 5 through ALA h 3 bound to THR b 1 source : AE6 11) chain b residue 1 type sequence T description binding site for Ligand GAU h 4 bound to THR b 1 source : AE7 12) chain b residue 20 type sequence T description binding site for Ligand GAU h 4 bound to THR b 1 source : AE7 13) chain b residue 31 type sequence T description binding site for Ligand GAU h 4 bound to THR b 1 source : AE7 14) chain b residue 45 type sequence R description binding site for Ligand GAU h 4 bound to THR b 1 source : AE7 15) chain b residue 47 type sequence G description binding site for Ligand GAU h 4 bound to THR b 1 source : AE7 16) chain b residue 49 type sequence A description binding site for Ligand GAU h 4 bound to THR b 1 source : AE7 17) chain b residue 21 type sequence T description binding site for Di-peptide ACE h 1 and LEU h 2 source : AF4 18) chain b residue 48 type sequence S description binding site for Di-peptide ACE h 1 and LEU h 2 source : AF4 19) chain b residue 49 type sequence A description binding site for Di-peptide ACE h 1 and LEU h 2 source : AF4 20) chain b residue 1 type ACT_SITE sequence T description Nucleophile => ECO:0000269|PubMed:9087403 source Swiss-Prot : SWS_FT_FI1 21) chain b residue 4-51 type prosite sequence MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWC CRSGSAAD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. VGVkFnnGVVIAADtrstqgpivadknca.KlhrispkiwcagaGtaAD source prosite : PS00854

Display surface Download Links