eF-site ID 4y7w-K PDB Code 4y7w Chain K click to enlarge Title Yeast 20S proteasome in complex with Ac-LAE-ep Classification HYDROLASE/HYDROLASE INHIBITOR Compound Proteasome subunit alpha type-2 Source ORGANISM_COMMON: Baker's yeast; ORGANISM_SCIENTIFIC: Saccharomyces cerevisiae; Sequence K:  TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPF LLGTMAGGAADCQFWETWLGSQCRLHELREKERISVAAAS KILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGT RLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRS ILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKV KEEEGSFNNVIG Description Functional site 1) chain K residue 165 type sequence A description binding site for residue MG K 301 source : AC7 2) chain K residue 168 type sequence D description binding site for residue MG K 301 source : AC7 3) chain K residue 171 type sequence S description binding site for residue MG K 301 source : AC7 4) chain K residue 1 type sequence T description binding site for residue MES K 302 source : AC8 5) chain K residue 47 type sequence G description binding site for residue MES K 302 source : AC8 6) chain K residue 97 type sequence M description binding site for residue MES K 302 source : AC8 7) chain K residue 130 type sequence G description binding site for residue MES K 302 source : AC8 8) chain K residue 131 type sequence S description binding site for residue MES K 302 source : AC8 9) chain K residue 1 type sequence T description binding site for Ligand residues POL d 5 through ALA d 3 bound to THR K 1 source : AD7 10) chain K residue 19 type sequence R description binding site for Ligand residues POL d 5 through ALA d 3 bound to THR K 1 source : AD7 11) chain K residue 20 type sequence A description binding site for Ligand residues POL d 5 through ALA d 3 bound to THR K 1 source : AD7 12) chain K residue 21 type sequence T description binding site for Ligand residues POL d 5 through ALA d 3 bound to THR K 1 source : AD7 13) chain K residue 31 type sequence V description binding site for Ligand residues POL d 5 through ALA d 3 bound to THR K 1 source : AD7 14) chain K residue 45 type sequence M description binding site for Ligand residues POL d 5 through ALA d 3 bound to THR K 1 source : AD7 15) chain K residue 47 type sequence G description binding site for Ligand residues POL d 5 through ALA d 3 bound to THR K 1 source : AD7 16) chain K residue 49 type sequence A description binding site for Ligand residues POL d 5 through ALA d 3 bound to THR K 1 source : AD7 17) chain K residue 170 type sequence Y description binding site for Ligand residues POL d 5 through ALA d 3 bound to THR K 1 source : AD7 18) chain K residue 1 type sequence T description binding site for Ligand GAU d 4 bound to THR K 1 source : AD8 19) chain K residue 31 type sequence V description binding site for Ligand GAU d 4 bound to THR K 1 source : AD8 20) chain K residue 45 type sequence M description binding site for Ligand GAU d 4 bound to THR K 1 source : AD8 21) chain K residue 47 type sequence G description binding site for Ligand GAU d 4 bound to THR K 1 source : AD8 22) chain K residue 49 type sequence A description binding site for Ligand GAU d 4 bound to THR K 1 source : AD8 23) chain K residue 21 type sequence T description binding site for Di-peptide ACE d 1 and LEU d 2 source : AE9 24) chain K residue 27 type sequence A description binding site for Di-peptide ACE d 1 and LEU d 2 source : AE9 25) chain K residue 49 type sequence A description binding site for Di-peptide ACE d 1 and LEU d 2 source : AE9 26) chain K residue 4-51 type prosite sequence LAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLG TMAGGAAD description PROTEASOME_BETA_1 Proteasome beta-type subunits signature. VGVkFnnGVVIAADtrstqgpivadknca.KlhrispkiwcagaGtaAD source prosite : PS00854 27) chain K residue 49 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links