eF-site ID 4y04-A PDB Code 4y04 Chain A click to enlarge Title Crystal structure of dipeptidyl peptidase 11 (DPP11) from Porphyromonas gingivalis (Space) Classification HYDROLASE Compound Peptidase S46 Source (A0A076NW73_PORGN) Sequence A:  DEGMWLMQQLGRKYAQMKERGLKMKEYDLYNPNGTSLKDA VVLFDGGCTGEVVSDRGLVLTNHHCGYDMIQAHSTLEHNY LENGFWAMREADELPNKDISVVFIDKIEDVTDYVKKELKA IKDPNSMDYLSPKYLQKLADKKAGKNFSAKNPGLSVEIKA FYGGNLYLMFTKKTYTDVRLVGAPPSSIGKFGADTDNWIW PRHTGDFSIFRIYADKNGNPAPYSEDNVPLKPKRFFNISL GGVQENDYAMIMGFPGTTHRYFTASEVDEWKSIDNDIRIR MRDIRQGVMLREMLADPQIKIMYSAKYAASQNAYKRAIGA NWAIKTRGLRQNKQAMQDRLIAWGAKQGTPRYEEAVHEID ATVAKRADLRRRYWMIEEGIIRGIEFARSPIPTEARKEAI DKIRTRYSKFANKDYSAEVDKKVAVAMLTEYLKEIPYENL PLHLRLVKDRFAGDVQAYVDDIFARSVFGSEAQFDAFAAV PSVEKLAEDPMVLFASSVFDEYRKLYNELRPYDDPILRAQ RTYIAGLLEMDGDQDQFPDANLTLRFTYGQVKGYSPRDNV YYGHQTTLDGVMEKEDPDNWEFVVDPKLKAVYERKDFGRY ADRSGRMPVAFCATTHTTGGNSGSPVMNANGELIGLNFDR NWEGVGGDIQYLADYQRSIIVDIRYVLLVIDKVGGCQRLL DEMNIVP Description Functional site 1) chain A residue 218 type sequence N description binding site for residue K A 801 source : AC1 2) chain A residue 219 type sequence W description binding site for residue K A 801 source : AC1 3) chain A residue 672 type sequence D description binding site for residue K A 801 source : AC1 4) chain A residue 278 type sequence T description binding site for residue K A 802 source : AC2 5) chain A residue 651 type sequence T description binding site for residue K A 802 source : AC2 6) chain A residue 681 type sequence D description binding site for residue K A 802 source : AC2 7) chain A residue 60 type sequence D description binding site for residue GOL A 803 source : AC3 8) chain A residue 124 type sequence F description binding site for residue GOL A 803 source : AC3 9) chain A residue 194 type sequence K description binding site for residue GOL A 803 source : AC3 10) chain A residue 253 type sequence P description binding site for residue GOL A 803 source : AC3 11) chain A residue 254 type sequence K description binding site for residue GOL A 803 source : AC3 12) chain A residue 255 type sequence R description binding site for residue GOL A 803 source : AC3 13) chain A residue 85 type ACT_SITE sequence H description Charge relay system => ECO:0000250|UniProtKB:V5YM14, ECO:0000305|PubMed:26057589 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 227 type ACT_SITE sequence D description Charge relay system => ECO:0000250|UniProtKB:V5YM14, ECO:0000305|PubMed:26057589 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 655 type ACT_SITE sequence S description Charge relay system => ECO:0000250|UniProtKB:V5YM14, ECO:0000305|PubMed:21896480, ECO:0000305|PubMed:26057589 source Swiss-Prot : SWS_FT_FI2 16) chain A residue 673 type SITE sequence R description Is essential for the Asp/Glu P1 specificity of DPP11; involved in the recognition of the Asp/Glu residue at the P1 position of substrate peptides => ECO:0000269|PubMed:26057589 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links