eF-site ID 4xvc-F PDB Code 4xvc Chain F click to enlarge Title Crystal structure of an esterase from the bacterial hormone-sensitive lipase (HSL) family Classification HYDROLASE Compound Esterase E40 Source (4XVC) Sequence F:  MAKSPELDRVIGMIRERAATPRKTTDDDRRLYETMLGSMP LDDDIQTERLGVNGVPAEWIYAPGARDDQVFLYLHGGGYV IGSMRTHRVMLSHIARAAGCRVLGLDYRLAPETPFPAPVE DTVAAYRWLLAHGYDPSRIALGGDSAGGGLVVAALVALRY IGEPLPAAGVCLSPWIDMEATGESFTTNATMDPSVNKERV MSIAALYLGGKNPQAPLASPLYADLQGLPPLLVQVGGIET LLDDARALTTRAKAAGVDADLEVWDDMPHVWQHFAPILPE GKQAIARIGEFLRKQIG Description Functional site 1) chain F residue 76 type sequence G description binding site for residue PMS F 301 source : AC5 2) chain F residue 77 type sequence G description binding site for residue PMS F 301 source : AC5 3) chain F residue 78 type sequence G description binding site for residue PMS F 301 source : AC5 4) chain F residue 145 type sequence S description binding site for residue PMS F 301 source : AC5 5) chain F residue 146 type sequence A description binding site for residue PMS F 301 source : AC5 6) chain F residue 200 type sequence V description binding site for residue PMS F 301 source : AC5 7) chain F residue 269 type sequence H description binding site for residue PMS F 301 source : AC5

Display surface Download Links