eF-site ID 4xvc-H PDB Code 4xvc Chain H click to enlarge Title Crystal structure of an esterase from the bacterial hormone-sensitive lipase (HSL) family Classification HYDROLASE Compound Esterase E40 Source (4XVC) Sequence H:  MAKSPELDRVIGMIRERAATPRKTTDDDRRLYETMLGSMP LDDDIQTERLGVNGVPAEWIYAPGARDDQVFLYLHGGGYV IGSMRTHRVMLSHIARAAGCRVLGLDYRLAPETPFPAPVE DTVAAYRWLLAHGYDPSRIALGGDSAGGGLVVAALVALRY IGEPLPAAGVCLSPWIDMEATGESFTTNATMDPSVNKERV MSIAALYLGGKNPQAPLASPLYADLQGLPPLLVQVGGIET LLDDARALTTRAKAAGVDADLEVWDDMPHVWQHFAPILPE GKQAIARIGEFLRKQIG Description Functional site 1) chain H residue 77 type sequence G description binding site for residue PMS H 301 source : AC7 2) chain H residue 78 type sequence G description binding site for residue PMS H 301 source : AC7 3) chain H residue 145 type sequence S description binding site for residue PMS H 301 source : AC7 4) chain H residue 146 type sequence A description binding site for residue PMS H 301 source : AC7 5) chain H residue 175 type sequence W description binding site for residue PMS H 301 source : AC7 6) chain H residue 203 type sequence I description binding site for residue PMS H 301 source : AC7 7) chain H residue 269 type sequence H description binding site for residue PMS H 301 source : AC7

Display surface Download Links