eF-site ID 4xvc-G PDB Code 4xvc Chain G click to enlarge Title Crystal structure of an esterase from the bacterial hormone-sensitive lipase (HSL) family Classification HYDROLASE Compound Esterase E40 Source (4XVC) Sequence G:  MAKSPELDRVIGMIRERAATPRKTTDDDRRLYETMLGSMP LDDDIQTERLGVNGVPAEWIYAPGARDDQVFLYLHGGGYV IGSMRTHRVMLSHIARAAGCRVLGLDYRLAPETPFPAPVE DTVAAYRWLLAHGYDPSRIALGGDSAGGGLVVAALVALRY IGEPLPAAGVCLSPWIDMEATGESFTTNATMDPSVNKERV MSIAALYLGGKNPQAPLASPLYADLQGLPPLLVQVGGIET LLDDARALTTRAKAAGVDADLEVWDDMPHVWQHFAPILPE GKQAIARIGEFLRKQIG Description Functional site 1) chain G residue 77 type sequence G description binding site for residue PMS G 301 source : AC6 2) chain G residue 78 type sequence G description binding site for residue PMS G 301 source : AC6 3) chain G residue 145 type sequence S description binding site for residue PMS G 301 source : AC6 4) chain G residue 146 type sequence A description binding site for residue PMS G 301 source : AC6 5) chain G residue 175 type sequence W description binding site for residue PMS G 301 source : AC6 6) chain G residue 203 type sequence I description binding site for residue PMS G 301 source : AC6 7) chain G residue 269 type sequence H description binding site for residue PMS G 301 source : AC6

Display surface Download Links