eF-site ID 4xvc-B PDB Code 4xvc Chain B click to enlarge Title Crystal structure of an esterase from the bacterial hormone-sensitive lipase (HSL) family Classification HYDROLASE Compound Esterase E40 Source (4XVC) Sequence B:  MAKSPELDRVIGMIRERAATPRKTTDDDRRLYETMLGSMP LDDDIQTERLGVNGVPAEWIYAPGARDDQVFLYLHGGGYV IGSMRTHRVMLSHIARAAGCRVLGLDYRLAPETPFPAPVE DTVAAYRWLLAHGYDPSRIALGGDSAGGGLVVAALVALRY IGEPLPAAGVCLSPWIDMEATGESFTTNATMDPSVNKERV MSIAALYLGGKNPQAPLASPLYADLQGLPPLLVQVGGIET LLDDARALTTRAKAAGVDADLEVWDDMPHVWQHFAPILPE GKQAIARIGEFLRKQIG Description Functional site 1) chain B residue 76 type sequence G description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8 2) chain B residue 77 type sequence G description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8 3) chain B residue 78 type sequence G description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8 4) chain B residue 144 type sequence D description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8 5) chain B residue 146 type sequence A description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8 6) chain B residue 147 type sequence G description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8 7) chain B residue 148 type sequence G description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8 8) chain B residue 149 type sequence G description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8 9) chain B residue 172 type sequence L description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8 10) chain B residue 173 type sequence S description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8 11) chain B residue 174 type sequence P description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8 12) chain B residue 175 type sequence W description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8 13) chain B residue 203 type sequence I description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8 14) chain B residue 269 type sequence H description binding site for Di-peptide PMS B 301 and SER B 145 source : AC8

Display surface Download Links